BLASTX nr result
ID: Glycyrrhiza28_contig00022400
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00022400 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU49407.1 hypothetical protein TSUD_92530 [Trifolium subterraneum] 54 1e-06 >GAU49407.1 hypothetical protein TSUD_92530 [Trifolium subterraneum] Length = 645 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/47 (48%), Positives = 35/47 (74%) Frame = -2 Query: 205 LQIWQSEAGGRSQG*SYGTADMSVNVCRGASSLTRESRAPTTARTTH 65 +++W+ AGG+S+G YGTAD ++N+ RGA+SLT+ESR P + H Sbjct: 263 IELWKEAAGGKSRGRCYGTADFALNLRRGATSLTQESREPYSGTCDH 309