BLASTX nr result
ID: Glycyrrhiza28_contig00022107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00022107 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014622476.1 PREDICTED: uncharacterized protein LOC100815261 i... 152 2e-40 KHN23829.1 hypothetical protein glysoja_028122 [Glycine soja] 152 2e-40 XP_003545090.1 PREDICTED: uncharacterized protein LOC100815261 i... 152 2e-40 XP_006595682.1 PREDICTED: uncharacterized protein LOC100815261 i... 152 2e-40 KRH73930.1 hypothetical protein GLYMA_02G302000 [Glycine max] 151 3e-40 KHN43908.1 hypothetical protein glysoja_025947 [Glycine soja] 151 3e-40 XP_006575714.1 PREDICTED: uncharacterized protein LOC100819602 i... 151 3e-40 KYP73488.1 hypothetical protein KK1_006114 [Cajanus cajan] 151 3e-40 XP_006575713.1 PREDICTED: uncharacterized protein LOC100819602 i... 151 3e-40 XP_006575712.1 PREDICTED: uncharacterized protein LOC100819602 i... 151 3e-40 XP_007142439.1 hypothetical protein PHAVU_008G280600g [Phaseolus... 150 7e-40 XP_015972831.1 PREDICTED: GBF-interacting protein 1-like [Arachi... 147 6e-39 XP_016166334.1 PREDICTED: GBF-interacting protein 1-like [Arachi... 147 6e-39 XP_012568729.1 PREDICTED: uncharacterized protein LOC101489896 i... 147 1e-38 XP_012568727.1 PREDICTED: uncharacterized protein LOC101489896 i... 147 1e-38 XP_014504993.1 PREDICTED: uncharacterized protein LOC106765023 [... 146 2e-38 XP_017430421.1 PREDICTED: GBF-interacting protein 1-like [Vigna ... 146 2e-38 GAU28284.1 hypothetical protein TSUD_256120 [Trifolium subterran... 146 2e-38 XP_019435702.1 PREDICTED: GBF-interacting protein 1-like [Lupinu... 144 1e-37 XP_019426115.1 PREDICTED: GBF-interacting protein 1-like isoform... 141 1e-36 >XP_014622476.1 PREDICTED: uncharacterized protein LOC100815261 isoform X3 [Glycine max] Length = 764 Score = 152 bits (383), Expect = 2e-40 Identities = 75/79 (94%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >KHN23829.1 hypothetical protein glysoja_028122 [Glycine soja] Length = 765 Score = 152 bits (383), Expect = 2e-40 Identities = 75/79 (94%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >XP_003545090.1 PREDICTED: uncharacterized protein LOC100815261 isoform X2 [Glycine max] KRH14202.1 hypothetical protein GLYMA_14G012200 [Glycine max] Length = 765 Score = 152 bits (383), Expect = 2e-40 Identities = 75/79 (94%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >XP_006595682.1 PREDICTED: uncharacterized protein LOC100815261 isoform X1 [Glycine max] KRH14203.1 hypothetical protein GLYMA_14G012200 [Glycine max] Length = 773 Score = 152 bits (383), Expect = 2e-40 Identities = 75/79 (94%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >KRH73930.1 hypothetical protein GLYMA_02G302000 [Glycine max] Length = 760 Score = 151 bits (382), Expect = 3e-40 Identities = 74/79 (93%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >KHN43908.1 hypothetical protein glysoja_025947 [Glycine soja] Length = 764 Score = 151 bits (382), Expect = 3e-40 Identities = 74/79 (93%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >XP_006575714.1 PREDICTED: uncharacterized protein LOC100819602 isoform X3 [Glycine max] KRH73929.1 hypothetical protein GLYMA_02G302000 [Glycine max] Length = 764 Score = 151 bits (382), Expect = 3e-40 Identities = 74/79 (93%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >KYP73488.1 hypothetical protein KK1_006114 [Cajanus cajan] Length = 768 Score = 151 bits (382), Expect = 3e-40 Identities = 74/79 (93%), Positives = 77/79 (97%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEV+RRRD Sbjct: 11 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVKRRRD 70 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGL+S AS+ESR KQG Sbjct: 71 RKKEGLTSRASDESRLKQG 89 >XP_006575713.1 PREDICTED: uncharacterized protein LOC100819602 isoform X2 [Glycine max] Length = 768 Score = 151 bits (382), Expect = 3e-40 Identities = 74/79 (93%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >XP_006575712.1 PREDICTED: uncharacterized protein LOC100819602 isoform X1 [Glycine max] Length = 772 Score = 151 bits (382), Expect = 3e-40 Identities = 74/79 (93%), Positives = 76/79 (96%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYA+LRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 12 RVPIPNNVRKIIQDIREITGKQHTDDEIYAILRECSMDPNETAQKLLYLDTFHEVRRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS AS+E R KQG Sbjct: 72 RKKEGLSSRASDEPRLKQG 90 >XP_007142439.1 hypothetical protein PHAVU_008G280600g [Phaseolus vulgaris] ESW14433.1 hypothetical protein PHAVU_008G280600g [Phaseolus vulgaris] Length = 768 Score = 150 bits (379), Expect = 7e-40 Identities = 74/79 (93%), Positives = 75/79 (94%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 11 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 70 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSS S+E R KQG Sbjct: 71 RKKEGLSSRVSDEPRIKQG 89 >XP_015972831.1 PREDICTED: GBF-interacting protein 1-like [Arachis duranensis] Length = 775 Score = 147 bits (372), Expect = 6e-39 Identities = 72/79 (91%), Positives = 73/79 (92%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRK I DIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKTIHDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEG S SE+SRSKQG Sbjct: 69 RKKEGFGSRTSEDSRSKQG 87 >XP_016166334.1 PREDICTED: GBF-interacting protein 1-like [Arachis ipaensis] Length = 776 Score = 147 bits (372), Expect = 6e-39 Identities = 72/79 (91%), Positives = 73/79 (92%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRK I DIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKTIHDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEG S SE+SRSKQG Sbjct: 69 RKKEGFGSRTSEDSRSKQG 87 >XP_012568729.1 PREDICTED: uncharacterized protein LOC101489896 isoform X3 [Cicer arietinum] XP_012568730.1 PREDICTED: uncharacterized protein LOC101489896 isoform X4 [Cicer arietinum] Length = 742 Score = 147 bits (370), Expect = 1e-38 Identities = 72/78 (92%), Positives = 74/78 (94%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKII DIREITGKQHTD+EIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKIIHDIREITGKQHTDEEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 307 RKKEGLSSGASEESRSKQ 360 RKKEGL S SEESRSKQ Sbjct: 69 RKKEGLRSRVSEESRSKQ 86 >XP_012568727.1 PREDICTED: uncharacterized protein LOC101489896 isoform X1 [Cicer arietinum] XP_012568728.1 PREDICTED: uncharacterized protein LOC101489896 isoform X2 [Cicer arietinum] Length = 772 Score = 147 bits (370), Expect = 1e-38 Identities = 72/78 (92%), Positives = 74/78 (94%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRKII DIREITGKQHTD+EIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKIIHDIREITGKQHTDEEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 307 RKKEGLSSGASEESRSKQ 360 RKKEGL S SEESRSKQ Sbjct: 69 RKKEGLRSRVSEESRSKQ 86 >XP_014504993.1 PREDICTED: uncharacterized protein LOC106765023 [Vigna radiata var. radiata] Length = 767 Score = 146 bits (368), Expect = 2e-38 Identities = 71/79 (89%), Positives = 74/79 (93%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRK IQDIREITGKQHTDDEIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 11 RVPIPNNVRKTIQDIREITGKQHTDDEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 70 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLS+ S+E R KQG Sbjct: 71 RKKEGLSNRVSDEPRIKQG 89 >XP_017430421.1 PREDICTED: GBF-interacting protein 1-like [Vigna angularis] KOM46398.1 hypothetical protein LR48_Vigan07g010200 [Vigna angularis] BAT80576.1 hypothetical protein VIGAN_03016700 [Vigna angularis var. angularis] Length = 767 Score = 146 bits (368), Expect = 2e-38 Identities = 71/79 (89%), Positives = 74/79 (93%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRK IQDIREITGKQHTDDEIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 11 RVPIPNNVRKTIQDIREITGKQHTDDEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 70 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLS+ S+E R KQG Sbjct: 71 RKKEGLSNRVSDEPRIKQG 89 >GAU28284.1 hypothetical protein TSUD_256120 [Trifolium subterraneum] Length = 772 Score = 146 bits (368), Expect = 2e-38 Identities = 71/78 (91%), Positives = 74/78 (94%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIPNNVRK IQDIREITGKQHTDDEIYAVL+ECSMDPNETAQKLLYLDTFHEVRRRRD Sbjct: 9 RVPIPNNVRKTIQDIREITGKQHTDDEIYAVLKECSMDPNETAQKLLYLDTFHEVRRRRD 68 Query: 307 RKKEGLSSGASEESRSKQ 360 +KK+GLSS SEESRS Q Sbjct: 69 KKKDGLSSRVSEESRSNQ 86 >XP_019435702.1 PREDICTED: GBF-interacting protein 1-like [Lupinus angustifolius] OIW16406.1 hypothetical protein TanjilG_19122 [Lupinus angustifolius] Length = 777 Score = 144 bits (363), Expect = 1e-37 Identities = 70/79 (88%), Positives = 75/79 (94%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RVPIP+NVRK I +IREITGKQHTDDEIYAVLR+CSMDPNETAQKLLYLDTFHEV+RRRD Sbjct: 17 RVPIPDNVRKTIHNIREITGKQHTDDEIYAVLRDCSMDPNETAQKLLYLDTFHEVKRRRD 76 Query: 307 RKKEGLSSGASEESRSKQG 363 R KEGLSS ASE+SRSKQG Sbjct: 77 RNKEGLSSRASEDSRSKQG 95 >XP_019426115.1 PREDICTED: GBF-interacting protein 1-like isoform X2 [Lupinus angustifolius] Length = 763 Score = 141 bits (356), Expect = 1e-36 Identities = 70/79 (88%), Positives = 72/79 (91%) Frame = +1 Query: 127 RVPIPNNVRKIIQDIREITGKQHTDDEIYAVLRECSMDPNETAQKLLYLDTFHEVRRRRD 306 RV IPNNVRK IQ IREITGKQHTDDEIYAVLRECSMDPN+TAQKLLYLDTFHEV RRRD Sbjct: 12 RVSIPNNVRKTIQHIREITGKQHTDDEIYAVLRECSMDPNDTAQKLLYLDTFHEVTRRRD 71 Query: 307 RKKEGLSSGASEESRSKQG 363 RKKEGLSSG E+SR KQG Sbjct: 72 RKKEGLSSGDLEDSRMKQG 90