BLASTX nr result
ID: Glycyrrhiza28_contig00021957
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021957 (273 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019421643.1 PREDICTED: uncharacterized protein LOC109331536 i... 52 8e-06 XP_019421642.1 PREDICTED: uncharacterized protein LOC109331536 i... 52 8e-06 XP_019421641.1 PREDICTED: uncharacterized protein LOC109331536 i... 52 8e-06 XP_019421637.1 PREDICTED: uncharacterized protein LOC109331536 i... 52 8e-06 >XP_019421643.1 PREDICTED: uncharacterized protein LOC109331536 isoform X4 [Lupinus angustifolius] OIV94004.1 hypothetical protein TanjilG_07552 [Lupinus angustifolius] Length = 247 Score = 52.0 bits (123), Expect = 8e-06 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 88 MGDGPGKIKVICDHFQVPTSGVEYLENRTP-ITEPGTHTSFS 210 M D P ++K+I DHFQVP S +E ENRTP ITEPGT S S Sbjct: 1 MDDSPPRLKIIPDHFQVPVSSIESPENRTPTITEPGTDQSSS 42 >XP_019421642.1 PREDICTED: uncharacterized protein LOC109331536 isoform X3 [Lupinus angustifolius] Length = 250 Score = 52.0 bits (123), Expect = 8e-06 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 88 MGDGPGKIKVICDHFQVPTSGVEYLENRTP-ITEPGTHTSFS 210 M D P ++K+I DHFQVP S +E ENRTP ITEPGT S S Sbjct: 1 MDDSPPRLKIIPDHFQVPVSSIESPENRTPTITEPGTDQSSS 42 >XP_019421641.1 PREDICTED: uncharacterized protein LOC109331536 isoform X2 [Lupinus angustifolius] Length = 250 Score = 52.0 bits (123), Expect = 8e-06 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 88 MGDGPGKIKVICDHFQVPTSGVEYLENRTP-ITEPGTHTSFS 210 M D P ++K+I DHFQVP S +E ENRTP ITEPGT S S Sbjct: 1 MDDSPPRLKIIPDHFQVPVSSIESPENRTPTITEPGTDQSSS 42 >XP_019421637.1 PREDICTED: uncharacterized protein LOC109331536 isoform X1 [Lupinus angustifolius] XP_019421639.1 PREDICTED: uncharacterized protein LOC109331536 isoform X1 [Lupinus angustifolius] XP_019421640.1 PREDICTED: uncharacterized protein LOC109331536 isoform X1 [Lupinus angustifolius] Length = 253 Score = 52.0 bits (123), Expect = 8e-06 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 88 MGDGPGKIKVICDHFQVPTSGVEYLENRTP-ITEPGTHTSFS 210 M D P ++K+I DHFQVP S +E ENRTP ITEPGT S S Sbjct: 1 MDDSPPRLKIIPDHFQVPVSSIESPENRTPTITEPGTDQSSS 42