BLASTX nr result
ID: Glycyrrhiza28_contig00021937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021937 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004498539.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 2e-27 XP_003588542.1 PPR containing plant-like protein [Medicago trunc... 112 3e-27 XP_003545589.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 8e-24 XP_007161549.1 hypothetical protein PHAVU_001G078800g [Phaseolus... 100 6e-23 GAV85159.1 PPR domain-containing protein/PPR_3 domain-containing... 90 3e-19 XP_015885152.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 4e-19 KVH89955.1 Pentatricopeptide repeat-containing protein [Cynara c... 87 2e-18 XP_018833691.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 4e-18 XP_010254117.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 2e-17 XP_012855855.1 PREDICTED: protein Rf1, mitochondrial-like [Eryth... 86 2e-17 XP_011019666.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 4e-17 XP_002281582.2 PREDICTED: pentatricopeptide repeat-containing pr... 82 2e-16 CAN61515.1 hypothetical protein VITISV_033964 [Vitis vinifera] 82 3e-16 XP_007037681.2 PREDICTED: pentatricopeptide repeat-containing pr... 82 3e-16 EOY22182.1 Tetratricopeptide repeat-like superfamily protein, pu... 82 3e-16 CDP16154.1 unnamed protein product [Coffea canephora] 82 3e-16 XP_017620227.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 8e-16 XP_016666693.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 9e-16 XP_002309567.1 hypothetical protein POPTR_0006s25960g [Populus t... 80 1e-15 XP_010541647.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 1e-15 >XP_004498539.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Cicer arietinum] Length = 416 Score = 112 bits (280), Expect = 2e-27 Identities = 53/65 (81%), Positives = 62/65 (95%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 D+EKVICSYFRREAYDRLDIFLEC+K CYVL RS+YDLL+SGYRRA+LH+KVDS+LA++ Sbjct: 352 DIEKVICSYFRREAYDRLDIFLECIKK-CYVLPRSTYDLLMSGYRRANLHQKVDSILAEM 410 Query: 182 KSVGL 196 KSVGL Sbjct: 411 KSVGL 415 >XP_003588542.1 PPR containing plant-like protein [Medicago truncatula] AES58793.1 PPR containing plant-like protein [Medicago truncatula] Length = 428 Score = 112 bits (279), Expect = 3e-27 Identities = 55/65 (84%), Positives = 62/65 (95%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVICSYFR+EAYDRLDIFLEC+K+ CYV TRS+YDLLISGYRRA+LHEKVD VLAD+ Sbjct: 353 DVEKVICSYFRKEAYDRLDIFLECIKN-CYVHTRSTYDLLISGYRRANLHEKVDLVLADM 411 Query: 182 KSVGL 196 +SVGL Sbjct: 412 ESVGL 416 >XP_003545589.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Glycine max] KHN03081.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] KRH16223.1 hypothetical protein GLYMA_14G141400 [Glycine max] Length = 421 Score = 102 bits (255), Expect = 8e-24 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVICSYFRREAYDRLDIFLECLK CYVL +S+YDLLISGY+RA L EKV+ V+ D+ Sbjct: 357 DVEKVICSYFRREAYDRLDIFLECLK-RCYVLNKSTYDLLISGYKRARLLEKVERVMEDM 415 Query: 182 KSVGL 196 KS GL Sbjct: 416 KSAGL 420 >XP_007161549.1 hypothetical protein PHAVU_001G078800g [Phaseolus vulgaris] ESW33543.1 hypothetical protein PHAVU_001G078800g [Phaseolus vulgaris] Length = 418 Score = 100 bits (249), Expect = 6e-23 Identities = 51/65 (78%), Positives = 56/65 (86%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVICSYFRREAYDRLDIFLECLKS YVL +S+Y LLISGY+RA L EKVD V+ D+ Sbjct: 354 DVEKVICSYFRREAYDRLDIFLECLKSG-YVLKKSTYSLLISGYKRAHLLEKVDRVMKDL 412 Query: 182 KSVGL 196 KS GL Sbjct: 413 KSAGL 417 >GAV85159.1 PPR domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 410 Score = 90.1 bits (222), Expect = 3e-19 Identities = 42/64 (65%), Positives = 55/64 (85%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVIC YFR+ AYD L++FLE +K+S Y LTRS+YDLL++GYRRA L ++VDSV+ ++ Sbjct: 345 DVEKVICLYFRQAAYDSLELFLEHIKASYYELTRSNYDLLVAGYRRAGLSQRVDSVINEM 404 Query: 182 KSVG 193 KSVG Sbjct: 405 KSVG 408 >XP_015885152.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic-like, partial [Ziziphus jujuba] Length = 389 Score = 89.7 bits (221), Expect = 4e-19 Identities = 44/64 (68%), Positives = 54/64 (84%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 D+EKVICSYFRR AYDRLD+FLE +KSS Y LTRS+YDLL++GYRRA L +K+ V+ D+ Sbjct: 326 DIEKVICSYFRRAAYDRLDLFLERIKSS-YELTRSTYDLLVAGYRRAGLSDKLHLVINDM 384 Query: 182 KSVG 193 KS G Sbjct: 385 KSAG 388 >KVH89955.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 340 Score = 87.4 bits (215), Expect = 2e-18 Identities = 42/63 (66%), Positives = 54/63 (85%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKV+CSYFR+ AYDRLD+FLE +K+S Y L RS+Y+LL++GYRRA L+EKVD V+ D+ Sbjct: 275 DVEKVLCSYFRKGAYDRLDVFLEFIKNS-YKLPRSTYELLVAGYRRARLYEKVDLVIKDL 333 Query: 182 KSV 190 K V Sbjct: 334 KMV 336 >XP_018833691.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Juglans regia] Length = 420 Score = 87.4 bits (215), Expect = 4e-18 Identities = 45/65 (69%), Positives = 52/65 (80%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVICSYFRR AYDRLD+FLE +K YV RS+YDLLI+GYRRA L EK+D V+ + Sbjct: 356 DVEKVICSYFRRAAYDRLDVFLEQIK-DYYVPRRSTYDLLIAGYRRAGLSEKLDIVIEHM 414 Query: 182 KSVGL 196 KS GL Sbjct: 415 KSTGL 419 >XP_010254117.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Nelumbo nucifera] Length = 422 Score = 85.5 bits (210), Expect = 2e-17 Identities = 39/65 (60%), Positives = 56/65 (86%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEK+ICSYFRR AY+RLD+FLE ++ S Y+LT+S+YDLL++GYRRA L E+++SV+ D+ Sbjct: 358 DVEKIICSYFRRAAYERLDLFLERIRGS-YLLTKSTYDLLVAGYRRAGLSERLNSVVRDM 416 Query: 182 KSVGL 196 + G+ Sbjct: 417 ELAGI 421 >XP_012855855.1 PREDICTED: protein Rf1, mitochondrial-like [Erythranthe guttata] EYU21880.1 hypothetical protein MIMGU_mgv1a021905mg [Erythranthe guttata] Length = 422 Score = 85.5 bits (210), Expect = 2e-17 Identities = 42/64 (65%), Positives = 53/64 (82%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVICSYFR EAYDRLD+FLEC++ S Y LTRS Y+LL +GYRRA L EK+++V+ ++ Sbjct: 358 DVEKVICSYFRAEAYDRLDLFLECIRDS-YELTRSIYELLGAGYRRAGLSEKLNAVVNEM 416 Query: 182 KSVG 193 K G Sbjct: 417 KVAG 420 >XP_011019666.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Populus euphratica] Length = 451 Score = 84.7 bits (208), Expect = 4e-17 Identities = 43/65 (66%), Positives = 54/65 (83%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVI SYFR+EAY+RLD+FLE +KS Y LTRS+YDLL++GYRR L EK++ V+AD+ Sbjct: 388 DVEKVISSYFRQEAYERLDLFLEHIKSY-YKLTRSTYDLLVAGYRRVGLMEKLNLVMADM 446 Query: 182 KSVGL 196 K GL Sbjct: 447 KLAGL 451 >XP_002281582.2 PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Vitis vinifera] CBI20896.3 unnamed protein product, partial [Vitis vinifera] Length = 420 Score = 82.4 bits (202), Expect = 2e-16 Identities = 39/64 (60%), Positives = 52/64 (81%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 D+EKV+C+YFRREAY+RLD+FL +K S Y LT+S+YDLL++GYRRA L EK+D V+ + Sbjct: 356 DIEKVVCAYFRREAYERLDLFLGHIKGS-YKLTKSTYDLLVAGYRRAGLSEKLDLVMDGM 414 Query: 182 KSVG 193 K G Sbjct: 415 KLAG 418 >CAN61515.1 hypothetical protein VITISV_033964 [Vitis vinifera] Length = 1331 Score = 82.4 bits (202), Expect = 3e-16 Identities = 39/64 (60%), Positives = 52/64 (81%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 D+EKV+C+YFRREAY+RLD+FL +K S Y LT+S+YDLL++GYRRA L EK+D V+ + Sbjct: 1267 DIEKVVCAYFRREAYERLDLFLGHIKGS-YKLTKSTYDLLVAGYRRAGLSEKLDLVMDGM 1325 Query: 182 KSVG 193 K G Sbjct: 1326 KLAG 1329 >XP_007037681.2 PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Theobroma cacao] Length = 421 Score = 82.0 bits (201), Expect = 3e-16 Identities = 40/65 (61%), Positives = 54/65 (83%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVIC YFR+EAYDRLDIFLE +K S + L++S+YDLLI+GYRRA L +++D V+ D+ Sbjct: 357 DVEKVICCYFRKEAYDRLDIFLEHIKGS-HKLSKSTYDLLIAGYRRAGLSQRLDLVIKDM 415 Query: 182 KSVGL 196 + G+ Sbjct: 416 ELSGV 420 >EOY22182.1 Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 421 Score = 82.0 bits (201), Expect = 3e-16 Identities = 40/65 (61%), Positives = 54/65 (83%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVIC YFR+EAYDRLDIFLE +K S + L++S+YDLLI+GYRRA L +++D V+ D+ Sbjct: 357 DVEKVICCYFRKEAYDRLDIFLEHIKGS-HKLSKSTYDLLIAGYRRAGLSQRLDLVIKDM 415 Query: 182 KSVGL 196 + G+ Sbjct: 416 ELSGV 420 >CDP16154.1 unnamed protein product [Coffea canephora] Length = 422 Score = 82.0 bits (201), Expect = 3e-16 Identities = 38/64 (59%), Positives = 51/64 (79%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVE VIC YFR+ AY+RLD+FLEC++ S + L RS+YDLL++GYRRA L EK+D V+ ++ Sbjct: 356 DVENVICLYFRQAAYERLDLFLECIRDS-FTLRRSTYDLLVAGYRRAGLQEKLDMVIDEM 414 Query: 182 KSVG 193 K G Sbjct: 415 KQNG 418 >XP_017620227.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Gossypium arboreum] Length = 418 Score = 80.9 bits (198), Expect = 8e-16 Identities = 37/65 (56%), Positives = 53/65 (81%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKV+C YFR EAYDRLD+FLE +K S + L +S+YDLL++GYRRA L +++D+V+ D+ Sbjct: 354 DVEKVVCCYFREEAYDRLDLFLEHIKRS-HKLAKSTYDLLVAGYRRAGLSQRLDTVIKDM 412 Query: 182 KSVGL 196 + G+ Sbjct: 413 ELTGV 417 >XP_016666693.1 PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Gossypium hirsutum] Length = 471 Score = 80.9 bits (198), Expect = 9e-16 Identities = 37/65 (56%), Positives = 53/65 (81%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKV+C YFR EAYDRLD+FLE +K S + L +S+YDLL++GYRRA L +++D+V+ D+ Sbjct: 407 DVEKVVCCYFREEAYDRLDLFLEHIKRS-HKLAKSTYDLLVAGYRRAGLSQRLDTVIKDM 465 Query: 182 KSVGL 196 + G+ Sbjct: 466 ELTGV 470 >XP_002309567.1 hypothetical protein POPTR_0006s25960g [Populus trichocarpa] EEE93090.1 hypothetical protein POPTR_0006s25960g [Populus trichocarpa] Length = 424 Score = 80.5 bits (197), Expect = 1e-15 Identities = 40/65 (61%), Positives = 53/65 (81%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVI SYFR+EAY+RLD+FLE +K S Y LTRS+YDLL++GYRR L EK++ ++ D+ Sbjct: 361 DVEKVISSYFRQEAYERLDLFLEHIK-SYYKLTRSTYDLLVAGYRRVGLMEKLNLLMEDM 419 Query: 182 KSVGL 196 K G+ Sbjct: 420 KLAGV 424 >XP_010541647.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial-like [Tarenaya hassleriana] Length = 418 Score = 80.1 bits (196), Expect = 1e-15 Identities = 39/61 (63%), Positives = 52/61 (85%) Frame = +2 Query: 2 DVEKVICSYFRREAYDRLDIFLECLKSSCYVLTRSSYDLLISGYRRASLHEKVDSVLADI 181 DVEKVI +YFR EAYDRLD+FL+ +K S Y LTRS+YDLLI+GYRRA L EK+D+++ ++ Sbjct: 357 DVEKVISAYFRGEAYDRLDLFLDRIKGS-YCLTRSTYDLLIAGYRRARLPEKIDTMIKEM 415 Query: 182 K 184 + Sbjct: 416 E 416