BLASTX nr result
ID: Glycyrrhiza28_contig00021917
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021917 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU36371.1 hypothetical protein TSUD_151380 [Trifolium subterran... 147 3e-39 XP_013460711.1 pattern formation protein GNOM protein [Medicago ... 147 3e-39 XP_006591350.1 PREDICTED: ARF guanine-nucleotide exchange factor... 147 4e-39 KHN17902.1 Pattern formation protein EMB30 [Glycine soja] 147 4e-39 XP_014495823.1 PREDICTED: ARF guanine-nucleotide exchange factor... 147 4e-39 XP_017418527.1 PREDICTED: ARF guanine-nucleotide exchange factor... 147 4e-39 KHN07586.1 Pattern formation protein EMB30 [Glycine soja] 147 4e-39 XP_004503167.1 PREDICTED: ARF guanine-nucleotide exchange factor... 147 4e-39 XP_003552830.1 PREDICTED: ARF guanine-nucleotide exchange factor... 147 4e-39 BAT86006.1 hypothetical protein VIGAN_04361500 [Vigna angularis ... 147 4e-39 XP_016190177.1 PREDICTED: ARF guanine-nucleotide exchange factor... 144 2e-38 XP_015956541.1 PREDICTED: ARF guanine-nucleotide exchange factor... 144 2e-38 XP_007163446.1 hypothetical protein PHAVU_001G235300g [Phaseolus... 144 3e-38 XP_006373308.1 Pattern formation protein EMB30 [Populus trichoca... 142 2e-37 XP_017641649.1 PREDICTED: ARF guanine-nucleotide exchange factor... 141 4e-37 XP_016679731.1 PREDICTED: ARF guanine-nucleotide exchange factor... 141 4e-37 XP_016722910.1 PREDICTED: ARF guanine-nucleotide exchange factor... 141 4e-37 XP_012458866.1 PREDICTED: ARF guanine-nucleotide exchange factor... 141 4e-37 KHG15026.1 Pattern formation EMB30 -like protein [Gossypium arbo... 141 4e-37 XP_019439445.1 PREDICTED: ARF guanine-nucleotide exchange factor... 140 7e-37 >GAU36371.1 hypothetical protein TSUD_151380 [Trifolium subterraneum] Length = 1231 Score = 147 bits (371), Expect = 3e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 641 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVHGKPIVNSLS 700 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 701 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 728 >XP_013460711.1 pattern formation protein GNOM protein [Medicago truncatula] KEH34745.1 pattern formation protein GNOM protein [Medicago truncatula] Length = 1474 Score = 147 bits (371), Expect = 3e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 884 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVHGKPIVNSLS 943 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 944 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 971 >XP_006591350.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Glycine max] XP_006591351.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Glycine max] XP_006591352.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Glycine max] KRH31012.1 hypothetical protein GLYMA_11G221800 [Glycine max] KRH31013.1 hypothetical protein GLYMA_11G221800 [Glycine max] Length = 1262 Score = 147 bits (370), Expect = 4e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 883 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESEHSAETVHGKPIMNSLS 942 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 943 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 970 >KHN17902.1 Pattern formation protein EMB30 [Glycine soja] Length = 1472 Score = 147 bits (370), Expect = 4e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 883 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESEHSAETVHGKPIMNSLS 942 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 943 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 970 >XP_014495823.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Vigna radiata var. radiata] Length = 1473 Score = 147 bits (370), Expect = 4e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 883 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVHGKPIMNSLS 942 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 943 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 970 >XP_017418527.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Vigna angularis] KOM39175.1 hypothetical protein LR48_Vigan03g255700 [Vigna angularis] Length = 1473 Score = 147 bits (370), Expect = 4e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 883 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVHGKPIMNSLS 942 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 943 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 970 >KHN07586.1 Pattern formation protein EMB30 [Glycine soja] Length = 1473 Score = 147 bits (370), Expect = 4e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 883 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVHGKPIMNSLS 942 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 943 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 970 >XP_004503167.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Cicer arietinum] Length = 1473 Score = 147 bits (370), Expect = 4e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 883 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVHGKPILNSLS 942 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 943 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 970 >XP_003552830.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Glycine max] XP_006601990.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Glycine max] KRG97867.1 hypothetical protein GLYMA_18G035800 [Glycine max] Length = 1473 Score = 147 bits (370), Expect = 4e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 883 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVHGKPIMNSLS 942 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 943 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 970 >BAT86006.1 hypothetical protein VIGAN_04361500 [Vigna angularis var. angularis] Length = 1495 Score = 147 bits (370), Expect = 4e-39 Identities = 75/88 (85%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKPI NSLS Sbjct: 905 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVHGKPIMNSLS 964 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 965 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 992 >XP_016190177.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Arachis ipaensis] Length = 1472 Score = 144 bits (364), Expect = 2e-38 Identities = 73/88 (82%), Positives = 74/88 (84%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKP+ NSLS Sbjct: 882 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSSETVHGKPVTNSLS 941 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHM SIGTPRRSSGLMGRFSQLLSLDT Sbjct: 942 SAHMPSIGTPRRSSGLMGRFSQLLSLDT 969 >XP_015956541.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Arachis duranensis] Length = 1472 Score = 144 bits (364), Expect = 2e-38 Identities = 73/88 (82%), Positives = 74/88 (84%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETVHGKP+ NSLS Sbjct: 882 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSSETVHGKPVTNSLS 941 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHM SIGTPRRSSGLMGRFSQLLSLDT Sbjct: 942 SAHMPSIGTPRRSSGLMGRFSQLLSLDT 969 >XP_007163446.1 hypothetical protein PHAVU_001G235300g [Phaseolus vulgaris] XP_007163447.1 hypothetical protein PHAVU_001G235300g [Phaseolus vulgaris] ESW35440.1 hypothetical protein PHAVU_001G235300g [Phaseolus vulgaris] ESW35441.1 hypothetical protein PHAVU_001G235300g [Phaseolus vulgaris] Length = 1473 Score = 144 bits (363), Expect = 3e-38 Identities = 74/88 (84%), Positives = 75/88 (85%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV ETV+GKPI NSLS Sbjct: 883 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSAETVNGKPIMNSLS 942 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 943 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 970 >XP_006373308.1 Pattern formation protein EMB30 [Populus trichocarpa] ERP51105.1 Pattern formation protein EMB30 [Populus trichocarpa] Length = 1470 Score = 142 bits (358), Expect = 2e-37 Identities = 71/88 (80%), Positives = 73/88 (82%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV + VHGKPI NSLS Sbjct: 881 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELAADPVHGKPITNSLS 940 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 S HMQS+GTPRRSSGLMGRFSQLLSLDT Sbjct: 941 SVHMQSMGTPRRSSGLMGRFSQLLSLDT 968 >XP_017641649.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM [Gossypium arboreum] XP_017641650.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM [Gossypium arboreum] XP_017641651.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM [Gossypium arboreum] Length = 1464 Score = 141 bits (355), Expect = 4e-37 Identities = 71/88 (80%), Positives = 73/88 (82%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV + HGKPI NSLS Sbjct: 879 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSADPGHGKPITNSLS 938 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAH+QSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 939 SAHLQSIGTPRRSSGLMGRFSQLLSLDT 966 >XP_016679731.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Gossypium hirsutum] XP_016679732.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Gossypium hirsutum] XP_016679733.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Gossypium hirsutum] XP_016679734.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Gossypium hirsutum] Length = 1464 Score = 141 bits (355), Expect = 4e-37 Identities = 71/88 (80%), Positives = 73/88 (82%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV + HGKPI NSLS Sbjct: 879 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSADPGHGKPITNSLS 938 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAH+QSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 939 SAHLQSIGTPRRSSGLMGRFSQLLSLDT 966 >XP_016722910.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Gossypium hirsutum] XP_016722911.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Gossypium hirsutum] XP_016722912.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Gossypium hirsutum] Length = 1464 Score = 141 bits (355), Expect = 4e-37 Identities = 71/88 (80%), Positives = 73/88 (82%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV + HGKPI NSLS Sbjct: 879 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSADPGHGKPITNSLS 938 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAH+QSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 939 SAHLQSIGTPRRSSGLMGRFSQLLSLDT 966 >XP_012458866.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM [Gossypium raimondii] XP_012458867.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM [Gossypium raimondii] XP_012458868.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM [Gossypium raimondii] XP_012458870.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM [Gossypium raimondii] KJB78256.1 hypothetical protein B456_012G186300 [Gossypium raimondii] KJB78257.1 hypothetical protein B456_012G186300 [Gossypium raimondii] KJB78258.1 hypothetical protein B456_012G186300 [Gossypium raimondii] KJB78259.1 hypothetical protein B456_012G186300 [Gossypium raimondii] Length = 1464 Score = 141 bits (355), Expect = 4e-37 Identities = 71/88 (80%), Positives = 73/88 (82%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV + HGKPI NSLS Sbjct: 879 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSADPGHGKPITNSLS 938 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAH+QSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 939 SAHLQSIGTPRRSSGLMGRFSQLLSLDT 966 >KHG15026.1 Pattern formation EMB30 -like protein [Gossypium arboreum] Length = 1464 Score = 141 bits (355), Expect = 4e-37 Identities = 71/88 (80%), Positives = 73/88 (82%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARV + HGKPI NSLS Sbjct: 879 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADESELSADPGHGKPITNSLS 938 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAH+QSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 939 SAHLQSIGTPRRSSGLMGRFSQLLSLDT 966 >XP_019439445.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Lupinus angustifolius] XP_019439446.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Lupinus angustifolius] XP_019439447.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Lupinus angustifolius] OIW14185.1 hypothetical protein TanjilG_21325 [Lupinus angustifolius] Length = 1472 Score = 140 bits (353), Expect = 7e-37 Identities = 72/88 (81%), Positives = 72/88 (81%) Frame = -2 Query: 266 FTIANRYGDYIRTGWRNILDCILRLHKLGLLPARVXXXXXXXXXXXXETVHGKPIANSLS 87 FTI N YGDYIRTGWRNILDCILRLHKLGLLPARV ETV GKPI NSLS Sbjct: 882 FTIVNTYGDYIRTGWRNILDCILRLHKLGLLPARVASDAADDSELSAETVQGKPITNSLS 941 Query: 86 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 3 SAHMQSIGTPRRSSGLMGRFSQLLSLDT Sbjct: 942 SAHMQSIGTPRRSSGLMGRFSQLLSLDT 969