BLASTX nr result
ID: Glycyrrhiza28_contig00021710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021710 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACS44169.1 Hypothetical protein MexAM1_p2METAp0034 (plasmid) [Me... 87 6e-21 WP_043768371.1 ferredoxin [Methylobacterium extorquens] 65 5e-12 ACS44170.1 conserved hypothetical protein (plasmid) [Methylobact... 65 7e-12 WP_009865580.1 ferredoxin [Methylobacterium extorquens] ACS40381... 62 2e-10 WP_048462841.1 ferredoxin [Methylobacterium aquaticum] KMO38817.... 60 5e-10 WP_003598663.1 ferredoxin [Methylobacterium extorquens] ACK81999... 60 9e-10 WP_056385391.1 hypothetical protein [Methylobacterium sp. Leaf46... 60 9e-10 WP_056497061.1 hypothetical protein [Methylobacterium sp. Leaf11... 60 9e-10 WP_055958992.1 MULTISPECIES: hypothetical protein [Methylobacter... 60 9e-10 GAN46242.1 ferredoxin [Methylobacterium sp. ME121] 60 9e-10 WP_015821476.1 ferredoxin [Methylobacterium extorquens] CAX22878... 60 9e-10 KZC00255.1 hypothetical protein AU375_03409 [Methylobacterium ra... 59 1e-09 WP_043073020.1 ferredoxin [Methylobacterium sp. C1] KIU37269.1 f... 59 1e-09 WP_012454419.1 ferredoxin [Methylobacterium populi] ACB80694.1 p... 59 1e-09 BAR47326.1 ferredoxin (plasmid) [Methylobacterium aquaticum] 59 2e-09 SFF28599.1 hypothetical protein SAMN04487844_113139 [Methylobact... 59 3e-09 SCZ08544.1 hypothetical protein SAMN02927923_03964 [Microvirga g... 58 4e-09 ANY84757.1 ferredoxin (plasmid) [Microvirga sp. V5/3M] 58 4e-09 WP_007565541.1 MULTISPECIES: hypothetical protein [Methylobacter... 58 4e-09 WP_048446321.1 ferredoxin [Methylobacterium variabile] KMO33096.... 57 8e-09 >ACS44169.1 Hypothetical protein MexAM1_p2METAp0034 (plasmid) [Methylobacterium extorquens AM1] Length = 74 Score = 87.0 bits (214), Expect = 6e-21 Identities = 43/60 (71%), Positives = 43/60 (71%) Frame = +3 Query: 3 KVVRERGQHAAMHRAMPPVRREXXXXXXXXXXXXXXXXXYPALRPGTAASVHMVWSSHYA 182 KVVRERGQHAAMHRAMPPVRRE YPALRPGTAASVHMVWSSHYA Sbjct: 10 KVVRERGQHAAMHRAMPPVRRELSEDGGLSLGLGWSISGYPALRPGTAASVHMVWSSHYA 69 >WP_043768371.1 ferredoxin [Methylobacterium extorquens] Length = 110 Score = 65.5 bits (158), Expect = 5e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCESVGNMQQCIEQCRRCAESCRKMAA Sbjct: 82 ARSCESVGNMQQCIEQCRRCAESCRKMAA 110 >ACS44170.1 conserved hypothetical protein (plasmid) [Methylobacterium extorquens AM1] Length = 123 Score = 65.5 bits (158), Expect = 7e-12 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCESVGNMQQCIEQCRRCAESCRKMAA Sbjct: 95 ARSCESVGNMQQCIEQCRRCAESCRKMAA 123 >WP_009865580.1 ferredoxin [Methylobacterium extorquens] ACS40381.1 conserved hypothetical protein [Methylobacterium extorquens AM1] Length = 110 Score = 61.6 bits (148), Expect = 2e-10 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQQC+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQQCVEQCRRCAESCRKMAA 110 >WP_048462841.1 ferredoxin [Methylobacterium aquaticum] KMO38817.1 ferredoxin [Methylobacterium aquaticum] Length = 110 Score = 60.5 bits (145), Expect = 5e-10 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ+C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQECVEQCRRCAESCRKMAA 110 >WP_003598663.1 ferredoxin [Methylobacterium extorquens] ACK81999.1 protein of unknown function DUF326 [Methylobacterium extorquens CM4] ACS43116.1 conserved hypothetical protein (plasmid) [Methylobacterium extorquens AM1] EHP93491.1 protein of unknown function DUF326 [Methylobacterium extorquens DSM 13060] Length = 110 Score = 59.7 bits (143), Expect = 9e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQSCVEQCRRCAESCRKMAA 110 >WP_056385391.1 hypothetical protein [Methylobacterium sp. Leaf469] KQT97595.1 ferredoxin [Methylobacterium sp. Leaf469] Length = 110 Score = 59.7 bits (143), Expect = 9e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQHCVEQCRRCAESCRKMAA 110 >WP_056497061.1 hypothetical protein [Methylobacterium sp. Leaf111] KQP51123.1 ferredoxin [Methylobacterium sp. Leaf111] Length = 110 Score = 59.7 bits (143), Expect = 9e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQDCVEQCRRCAESCRKMAA 110 >WP_055958992.1 MULTISPECIES: hypothetical protein [Methylobacterium] KQO42430.1 ferredoxin [Methylobacterium sp. Leaf85] KQP29613.1 ferredoxin [Methylobacterium sp. Leaf104] KQQ24189.1 ferredoxin [Methylobacterium sp. Leaf125] Length = 110 Score = 59.7 bits (143), Expect = 9e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQHCVEQCRRCAESCRKMAA 110 >GAN46242.1 ferredoxin [Methylobacterium sp. ME121] Length = 110 Score = 59.7 bits (143), Expect = 9e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQDCVEQCRRCAESCRKMAA 110 >WP_015821476.1 ferredoxin [Methylobacterium extorquens] CAX22878.1 conserved hypothetical protein [Methylobacterium extorquens DM4] Length = 110 Score = 59.7 bits (143), Expect = 9e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQSCVEQCRRCAESCRKMAA 110 >KZC00255.1 hypothetical protein AU375_03409 [Methylobacterium radiotolerans] BAU91393.1 hypothetical protein MPPM_2788 [Methylobacterium populi] Length = 110 Score = 59.3 bits (142), Expect = 1e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQACVEQCRRCAESCRKMAA 110 >WP_043073020.1 ferredoxin [Methylobacterium sp. C1] KIU37269.1 ferredoxin [Methylobacterium radiotolerans] KZB97426.1 hypothetical protein AU375_06422 [Methylobacterium radiotolerans] Length = 110 Score = 59.3 bits (142), Expect = 1e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQACVEQCRRCAESCRKMAA 110 >WP_012454419.1 ferredoxin [Methylobacterium populi] ACB80694.1 protein of unknown function DUF326 [Methylobacterium populi BJ001] OAH33445.1 ferredoxin [Methylobacterium populi] Length = 110 Score = 59.3 bits (142), Expect = 1e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQACVEQCRRCAESCRKMAA 110 >BAR47326.1 ferredoxin (plasmid) [Methylobacterium aquaticum] Length = 86 Score = 58.5 bits (140), Expect = 2e-09 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C++QCRRCAESCRKMAA Sbjct: 58 ARSCEQVGDMQHCVDQCRRCAESCRKMAA 86 >SFF28599.1 hypothetical protein SAMN04487844_113139 [Methylobacterium sp. yr596] Length = 110 Score = 58.5 bits (140), Expect = 3e-09 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C++QCRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQHCVDQCRRCAESCRKMAA 110 >SCZ08544.1 hypothetical protein SAMN02927923_03964 [Microvirga guangxiensis] Length = 110 Score = 58.2 bits (139), Expect = 4e-09 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ+C++QCRRCAESCR+MAA Sbjct: 82 ARSCEQVGDMQECVDQCRRCAESCRRMAA 110 >ANY84757.1 ferredoxin (plasmid) [Microvirga sp. V5/3M] Length = 110 Score = 58.2 bits (139), Expect = 4e-09 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 A+SCE VG+MQ+C++QCRRCAESCRKMAA Sbjct: 82 AKSCEQVGDMQECVDQCRRCAESCRKMAA 110 >WP_007565541.1 MULTISPECIES: hypothetical protein [Methylobacterium] EIZ83296.1 ferredoxin [Methylobacterium sp. GXF4] SFU92288.1 hypothetical protein SAMN02799643_03184 [Methylobacterium sp. UNCCL125] Length = 110 Score = 58.2 bits (139), Expect = 4e-09 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+E+CRRCAESCRKMAA Sbjct: 82 ARSCEQVGDMQDCVERCRRCAESCRKMAA 110 >WP_048446321.1 ferredoxin [Methylobacterium variabile] KMO33096.1 ferredoxin [Methylobacterium variabile] Length = 110 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 1 ARSCESVGNMQQCIEQCRRCAESCRKMAA 87 ARSCE VG+MQ C+EQCRRCAESCR MAA Sbjct: 82 ARSCEQVGDMQHCVEQCRRCAESCRTMAA 110