BLASTX nr result
ID: Glycyrrhiza28_contig00021602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021602 (244 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018480864.1 PREDICTED: protein BUD31 homolog 1-like isoform X... 68 3e-12 NP_001237406.1 uncharacterized protein LOC100527276 [Glycine max... 65 2e-11 CDP15769.1 unnamed protein product [Coffea canephora] 64 3e-11 OAY42871.1 hypothetical protein MANES_08G022800 [Manihot esculenta] 64 4e-11 XP_012066454.1 PREDICTED: protein BUD31 homolog 2 isoform X1 [Ja... 64 7e-11 XP_006430267.1 hypothetical protein CICLE_v10013306mg [Citrus cl... 60 9e-11 XP_016196951.1 PREDICTED: protein BUD31 homolog 2-like [Arachis ... 63 9e-11 XP_014522581.1 PREDICTED: protein BUD31 homolog 2-like [Vigna ra... 62 9e-11 XP_019158406.1 PREDICTED: protein BUD31 homolog 2-like [Ipomoea ... 63 1e-10 XP_019181167.1 PREDICTED: protein BUD31 homolog 2 [Ipomoea nil] 63 1e-10 CDP05470.1 unnamed protein product [Coffea canephora] 63 1e-10 XP_016437108.1 PREDICTED: protein BUD31 homolog 2-like [Nicotian... 62 1e-10 OMO95770.1 G10 protein [Corchorus capsularis] OMP07240.1 G10 pro... 62 2e-10 XP_018839780.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia... 62 2e-10 XP_018839767.1 PREDICTED: protein BUD31 homolog 2-like [Juglans ... 62 2e-10 XP_015901947.1 PREDICTED: protein BUD31 homolog 2 [Ziziphus jujuba] 62 2e-10 XP_011094396.1 PREDICTED: protein BUD31 homolog 2-like [Sesamum ... 62 2e-10 XP_011077892.1 PREDICTED: protein BUD31 homolog 2 [Sesamum indicum] 62 2e-10 XP_012475822.1 PREDICTED: protein BUD31 homolog 2 [Gossypium rai... 62 2e-10 XP_010049717.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus gr... 62 2e-10 >XP_018480864.1 PREDICTED: protein BUD31 homolog 1-like isoform X1 [Raphanus sativus] Length = 190 Score = 67.8 bits (164), Expect = 3e-12 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = +1 Query: 88 SFVPFLNTNGFYLRDIYEQR*KMPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 S++ ++N LR + + KMPKVKTNR++YPEGWELIEPTL E +AKMR Sbjct: 24 SYLSSSSSNSLVLRQLVSPKKKMPKVKTNRIKYPEGWELIEPTLREFEAKMR 75 >NP_001237406.1 uncharacterized protein LOC100527276 [Glycine max] ACU16333.1 unknown [Glycine max] KHN40313.1 Protein BUD31 like 2 [Glycine soja] KRH49080.1 hypothetical protein GLYMA_07G130900 [Glycine max] KRH49081.1 hypothetical protein GLYMA_07G130900 [Glycine max] Length = 145 Score = 64.7 bits (156), Expect = 2e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV YPEGWELIEPTLHELQAKMR Sbjct: 1 MPKVKTNRVTYPEGWELIEPTLHELQAKMR 30 >CDP15769.1 unnamed protein product [Coffea canephora] Length = 145 Score = 64.3 bits (155), Expect = 3e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRVQYPEGWELIEPTL+ELQAKMR Sbjct: 1 MPKVKTNRVQYPEGWELIEPTLNELQAKMR 30 >OAY42871.1 hypothetical protein MANES_08G022800 [Manihot esculenta] Length = 150 Score = 64.3 bits (155), Expect = 4e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 151 KMPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 KMPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 5 KMPKVKTNRVKYPEGWELIEPTLRELQAKMR 35 >XP_012066454.1 PREDICTED: protein BUD31 homolog 2 isoform X1 [Jatropha curcas] Length = 189 Score = 64.3 bits (155), Expect = 7e-11 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +1 Query: 115 GFYLRDIYEQR*-KMPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 G Y+ D+ +++ +MPKVKTNRV+YPEGWELIEPTL ELQ+KMR Sbjct: 31 GKYMGDVIKKKKQRMPKVKTNRVKYPEGWELIEPTLRELQSKMR 74 >XP_006430267.1 hypothetical protein CICLE_v10013306mg [Citrus clementina] ESR43507.1 hypothetical protein CICLE_v10013306mg [Citrus clementina] Length = 37 Score = 60.5 bits (145), Expect = 9e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRVQ PEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVQNPEGWELIEPTLRELQAKMR 30 >XP_016196951.1 PREDICTED: protein BUD31 homolog 2-like [Arachis ipaensis] Length = 145 Score = 63.2 bits (152), Expect = 9e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL+ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLYELQAKMR 30 >XP_014522581.1 PREDICTED: protein BUD31 homolog 2-like [Vigna radiata var. radiata] Length = 115 Score = 62.4 bits (150), Expect = 9e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_019158406.1 PREDICTED: protein BUD31 homolog 2-like [Ipomoea nil] XP_019158407.1 PREDICTED: protein BUD31 homolog 2-like [Ipomoea nil] Length = 145 Score = 62.8 bits (151), Expect = 1e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL+ELQAKMR Sbjct: 1 MPKVKTNRVRYPEGWELIEPTLNELQAKMR 30 >XP_019181167.1 PREDICTED: protein BUD31 homolog 2 [Ipomoea nil] Length = 145 Score = 62.8 bits (151), Expect = 1e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL+ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLNELQAKMR 30 >CDP05470.1 unnamed protein product [Coffea canephora] Length = 145 Score = 62.8 bits (151), Expect = 1e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL+ELQAKMR Sbjct: 1 MPKVKTNRVRYPEGWELIEPTLNELQAKMR 30 >XP_016437108.1 PREDICTED: protein BUD31 homolog 2-like [Nicotiana tabacum] XP_016437109.1 PREDICTED: protein BUD31 homolog 2-like [Nicotiana tabacum] XP_016437110.1 PREDICTED: protein BUD31 homolog 2-like [Nicotiana tabacum] XP_016437111.1 PREDICTED: protein BUD31 homolog 2-like [Nicotiana tabacum] XP_016437113.1 PREDICTED: protein BUD31 homolog 2-like [Nicotiana tabacum] XP_016437114.1 PREDICTED: protein BUD31 homolog 2-like [Nicotiana tabacum] Length = 114 Score = 62.0 bits (149), Expect = 1e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLSELQAKMR 30 >OMO95770.1 G10 protein [Corchorus capsularis] OMP07240.1 G10 protein [Corchorus olitorius] Length = 145 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_018839780.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839781.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839783.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839784.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839785.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839786.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] XP_018839787.1 PREDICTED: protein BUD31 homolog 2 [Juglans regia] Length = 145 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_018839767.1 PREDICTED: protein BUD31 homolog 2-like [Juglans regia] XP_018839768.1 PREDICTED: protein BUD31 homolog 2-like [Juglans regia] Length = 145 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_015901947.1 PREDICTED: protein BUD31 homolog 2 [Ziziphus jujuba] Length = 145 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_011094396.1 PREDICTED: protein BUD31 homolog 2-like [Sesamum indicum] Length = 145 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_011077892.1 PREDICTED: protein BUD31 homolog 2 [Sesamum indicum] Length = 145 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_012475822.1 PREDICTED: protein BUD31 homolog 2 [Gossypium raimondii] XP_016716203.1 PREDICTED: protein BUD31 homolog 2 [Gossypium hirsutum] XP_016703313.1 PREDICTED: protein BUD31 homolog 2 [Gossypium hirsutum] XP_017624217.1 PREDICTED: protein BUD31 homolog 2 [Gossypium arboreum] KHG22385.1 hypothetical protein F383_27796 [Gossypium arboreum] KJB25466.1 hypothetical protein B456_004G193300 [Gossypium raimondii] Length = 145 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30 >XP_010049717.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] XP_018730114.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] XP_018730118.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] XP_018730121.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] XP_018730122.1 PREDICTED: protein BUD31 homolog 2 [Eucalyptus grandis] Length = 145 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 154 MPKVKTNRVQYPEGWELIEPTLHELQAKMR 243 MPKVKTNRV+YPEGWELIEPTL ELQAKMR Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMR 30