BLASTX nr result
ID: Glycyrrhiza28_contig00021578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021578 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONI06106.1 hypothetical protein PRUPE_5G040800 [Prunus persica] 98 2e-24 XP_006385628.1 hypothetical protein POPTR_0003s08790g [Populus t... 98 6e-24 XP_018853959.1 PREDICTED: probable protein phosphatase 2C 26 [Ju... 96 9e-24 XP_009785866.1 PREDICTED: probable protein phosphatase 2C 26 [Ni... 96 2e-23 EYU17848.1 hypothetical protein MIMGU_mgv1a0231131mg, partial [E... 96 2e-23 KHN42615.1 Protein phosphatase 2C 29 [Glycine soja] 96 3e-23 XP_006436752.1 hypothetical protein CICLE_v100317272mg, partial ... 94 1e-22 XP_002519843.1 PREDICTED: protein phosphatase 2C 29 [Ricinus com... 98 7e-22 XP_007211303.1 hypothetical protein PRUPE_ppa001785mg [Prunus pe... 98 7e-22 XP_019445982.1 PREDICTED: protein phosphatase 2C 29-like [Lupinu... 98 7e-22 XP_019421604.1 PREDICTED: protein phosphatase 2C 29-like isoform... 98 7e-22 XP_004509008.1 PREDICTED: protein phosphatase 2C 29 isoform X1 [... 98 7e-22 GAV68148.1 PP2C domain-containing protein [Cephalotus follicularis] 98 7e-22 XP_008238289.1 PREDICTED: protein phosphatase 2C 29 [Prunus mume] 98 7e-22 XP_011028215.1 PREDICTED: protein phosphatase 2C 29-like [Populu... 98 7e-22 XP_003608636.2 protein phosphatase 2C family protein [Medicago t... 98 7e-22 XP_008373546.1 PREDICTED: protein phosphatase 2C 29 [Malus domes... 98 7e-22 XP_007039547.2 PREDICTED: protein phosphatase 2C 29 [Theobroma c... 98 7e-22 EOY24048.1 Poltergeist like 1 isoform 1 [Theobroma cacao] 98 7e-22 XP_011465169.1 PREDICTED: protein phosphatase 2C 29 [Fragaria ve... 98 7e-22 >ONI06106.1 hypothetical protein PRUPE_5G040800 [Prunus persica] Length = 120 Score = 97.8 bits (242), Expect = 2e-24 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 75 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 120 >XP_006385628.1 hypothetical protein POPTR_0003s08790g [Populus trichocarpa] ERP63425.1 hypothetical protein POPTR_0003s08790g [Populus trichocarpa] Length = 169 Score = 97.8 bits (242), Expect = 6e-24 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 124 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 169 >XP_018853959.1 PREDICTED: probable protein phosphatase 2C 26 [Juglans regia] Length = 120 Score = 95.9 bits (237), Expect = 9e-24 Identities = 43/46 (93%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVM++SLEGRIWK+SGKYL Sbjct: 75 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMIVSLEGRIWKTSGKYL 120 >XP_009785866.1 PREDICTED: probable protein phosphatase 2C 26 [Nicotiana sylvestris] Length = 133 Score = 95.5 bits (236), Expect = 2e-23 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLE RIWKSSGKYL Sbjct: 88 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEARIWKSSGKYL 133 >EYU17848.1 hypothetical protein MIMGU_mgv1a0231131mg, partial [Erythranthe guttata] Length = 167 Score = 96.3 bits (238), Expect = 2e-23 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AA+KAGMDFHELLDIPQGDRRKYHDDVTVMV+SLEGRIWKSSGKYL Sbjct: 122 AARKAGMDFHELLDIPQGDRRKYHDDVTVMVVSLEGRIWKSSGKYL 167 >KHN42615.1 Protein phosphatase 2C 29 [Glycine soja] Length = 170 Score = 95.9 bits (237), Expect = 3e-23 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKY 135 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMV+SLEGRIWKSSGKY Sbjct: 125 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVVSLEGRIWKSSGKY 169 >XP_006436752.1 hypothetical protein CICLE_v100317272mg, partial [Citrus clementina] ESR49992.1 hypothetical protein CICLE_v100317272mg, partial [Citrus clementina] Length = 167 Score = 94.4 bits (233), Expect = 1e-22 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAK+AGMD HELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 122 AAKRAGMDLHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 167 >XP_002519843.1 PREDICTED: protein phosphatase 2C 29 [Ricinus communis] EEF42447.1 protein phosphatase 2c, putative [Ricinus communis] Length = 749 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 704 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 749 >XP_007211303.1 hypothetical protein PRUPE_ppa001785mg [Prunus persica] Length = 765 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 720 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 765 >XP_019445982.1 PREDICTED: protein phosphatase 2C 29-like [Lupinus angustifolius] OIW10312.1 hypothetical protein TanjilG_28063 [Lupinus angustifolius] Length = 770 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 725 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 770 >XP_019421604.1 PREDICTED: protein phosphatase 2C 29-like isoform X1 [Lupinus angustifolius] OIV94056.1 hypothetical protein TanjilG_06356 [Lupinus angustifolius] Length = 774 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 729 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 774 >XP_004509008.1 PREDICTED: protein phosphatase 2C 29 isoform X1 [Cicer arietinum] Length = 775 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 730 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 775 >GAV68148.1 PP2C domain-containing protein [Cephalotus follicularis] Length = 777 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 732 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 777 >XP_008238289.1 PREDICTED: protein phosphatase 2C 29 [Prunus mume] Length = 777 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 732 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 777 >XP_011028215.1 PREDICTED: protein phosphatase 2C 29-like [Populus euphratica] Length = 779 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 734 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 779 >XP_003608636.2 protein phosphatase 2C family protein [Medicago truncatula] AES90833.2 protein phosphatase 2C family protein [Medicago truncatula] Length = 779 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 734 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 779 >XP_008373546.1 PREDICTED: protein phosphatase 2C 29 [Malus domestica] XP_008373547.1 PREDICTED: protein phosphatase 2C 29 [Malus domestica] XP_008373548.1 PREDICTED: protein phosphatase 2C 29 [Malus domestica] XP_008373549.1 PREDICTED: protein phosphatase 2C 29 [Malus domestica] Length = 780 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 735 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 780 >XP_007039547.2 PREDICTED: protein phosphatase 2C 29 [Theobroma cacao] Length = 786 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 741 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 786 >EOY24048.1 Poltergeist like 1 isoform 1 [Theobroma cacao] Length = 786 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 741 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 786 >XP_011465169.1 PREDICTED: protein phosphatase 2C 29 [Fragaria vesca subsp. vesca] Length = 787 Score = 97.8 bits (242), Expect = 7e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 1 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 138 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL Sbjct: 742 AAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGKYL 787