BLASTX nr result
ID: Glycyrrhiza28_contig00021521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021521 (850 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003630096.2 PPR containing plant-like protein [Medicago trunc... 64 7e-08 XP_004504032.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 7e-08 KYP74716.1 hypothetical protein KK1_007404 [Cajanus cajan] 64 7e-08 XP_015890905.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 5e-06 >XP_003630096.2 PPR containing plant-like protein [Medicago truncatula] AET04572.2 PPR containing plant-like protein [Medicago truncatula] Length = 476 Score = 63.9 bits (154), Expect = 7e-08 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 616 KKTSDQSETRELVCLPKQKISDKEPLVKTLNKYVKLVRTE 735 K+T+DQSET+ELV L +KISDKEPL+KTLNKYVKLVRTE Sbjct: 43 KQTTDQSETQELVRLLTRKISDKEPLLKTLNKYVKLVRTE 82 >XP_004504032.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Cicer arietinum] XP_004504033.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Cicer arietinum] Length = 477 Score = 63.9 bits (154), Expect = 7e-08 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 586 GSGSIRPKREKKTSDQSETRELVCLPKQKISDKEPLVKTLNKYVKLVRTE 735 GS R R+K TS++SET+ELV L +KIS+KEPLV TLNKYVKLVRTE Sbjct: 34 GSNPTRLNRKKITSERSETQELVRLLTRKISEKEPLVTTLNKYVKLVRTE 83 >KYP74716.1 hypothetical protein KK1_007404 [Cajanus cajan] Length = 518 Score = 63.9 bits (154), Expect = 7e-08 Identities = 38/52 (73%), Positives = 40/52 (76%) Frame = +1 Query: 580 CGGSGSIRPKREKKTSDQSETRELVCLPKQKISDKEPLVKTLNKYVKLVRTE 735 CG S PKR KKTS SE +ELV L +KISDKEPLVKTLNKYVKLVRTE Sbjct: 31 CGPS----PKR-KKTSHNSEAQELVRLLTRKISDKEPLVKTLNKYVKLVRTE 77 >XP_015890905.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Ziziphus jujuba] Length = 128 Score = 55.1 bits (131), Expect = 5e-06 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +1 Query: 595 SIRPKREKKT-SDQSETRELVCLPKQKISDKEPLVKTLNKYVKLVRTE 735 S RPKR+ + ++ SE ELV L + SDKEPL+KTLNKYVK+VRTE Sbjct: 49 STRPKRKSASKTESSEAEELVRLLMRSFSDKEPLLKTLNKYVKIVRTE 96