BLASTX nr result
ID: Glycyrrhiza28_contig00021455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021455 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003615412.1 lung seven transmembrane receptor family protein ... 85 1e-16 GAU50407.1 hypothetical protein TSUD_244540 [Trifolium subterran... 83 4e-16 XP_004490504.1 PREDICTED: transmembrane protein 87A isoform X1 [... 80 5e-15 XP_019431447.1 PREDICTED: transmembrane protein 87B-like [Lupinu... 80 6e-15 XP_019456799.1 PREDICTED: transmembrane protein 87A-like [Lupinu... 76 1e-13 XP_015870342.1 PREDICTED: transmembrane protein 87A-like [Ziziph... 70 1e-11 XP_011469996.1 PREDICTED: transmembrane protein 87A-like [Fragar... 70 2e-11 XP_009363789.1 PREDICTED: transmembrane protein 87B-like [Pyrus ... 68 1e-10 XP_009362785.1 PREDICTED: transmembrane protein 87A-like [Pyrus ... 68 1e-10 XP_008369378.1 PREDICTED: transmembrane protein 87A-like [Malus ... 67 2e-10 XP_017191784.1 PREDICTED: transmembrane protein 87A-like, partia... 65 1e-09 XP_008366805.1 PREDICTED: transmembrane protein 87A-like [Malus ... 65 1e-09 KNA18399.1 hypothetical protein SOVF_071200 [Spinacia oleracea] 62 7e-09 XP_008456965.1 PREDICTED: transmembrane protein 87A [Cucumis melo] 62 7e-09 ONI24833.1 hypothetical protein PRUPE_2G264800 [Prunus persica] 62 1e-08 XP_015580566.1 PREDICTED: transmembrane protein 87B [Ricinus com... 61 2e-08 KDO67540.1 hypothetical protein CISIN_1g042064mg [Citrus sinensis] 60 3e-08 XP_011076584.1 PREDICTED: transmembrane protein 87A-like [Sesamu... 60 3e-08 XP_019224647.1 PREDICTED: transmembrane protein 87B-like [Nicoti... 60 3e-08 XP_010252050.1 PREDICTED: transmembrane protein 87B [Nelumbo nuc... 60 3e-08 >XP_003615412.1 lung seven transmembrane receptor family protein [Medicago truncatula] AES98370.1 lung seven transmembrane receptor family protein [Medicago truncatula] Length = 541 Score = 84.7 bits (208), Expect = 1e-16 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFNDSEDKFPTGKS 3 ASIHDYQNETFI RANSFFFHGGSEGLYAS P FN S D FPTGKS Sbjct: 39 ASIHDYQNETFIRRANSFFFHGGSEGLYASKPIEFNHSLDNFPTGKS 85 >GAU50407.1 hypothetical protein TSUD_244540 [Trifolium subterraneum] Length = 544 Score = 83.2 bits (204), Expect = 4e-16 Identities = 41/50 (82%), Positives = 42/50 (84%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFN---DSEDKFPTGKS 3 ASIHDYQNETFI RANSFFFHGGSEGLYAS P SFN S+D FPTGKS Sbjct: 42 ASIHDYQNETFIRRANSFFFHGGSEGLYASKPISFNHSLSSQDNFPTGKS 91 >XP_004490504.1 PREDICTED: transmembrane protein 87A isoform X1 [Cicer arietinum] Length = 542 Score = 80.1 bits (196), Expect = 5e-15 Identities = 40/50 (80%), Positives = 41/50 (82%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFN---DSEDKFPTGKS 3 ASIHDYQNETFI RANSFFFHGGSEGLYAS P+S N SED PTGKS Sbjct: 37 ASIHDYQNETFIRRANSFFFHGGSEGLYASKPNSLNHSLHSEDTLPTGKS 86 >XP_019431447.1 PREDICTED: transmembrane protein 87B-like [Lupinus angustifolius] OIW16548.1 hypothetical protein TanjilG_08405 [Lupinus angustifolius] Length = 550 Score = 79.7 bits (195), Expect = 6e-15 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFNDSEDKFPTGKS 3 ASIHDY+NETFIHR+NSFFFHGGSEGLYAS SFND+ED GKS Sbjct: 50 ASIHDYENETFIHRSNSFFFHGGSEGLYASRVPSFNDTEDNSLNGKS 96 >XP_019456799.1 PREDICTED: transmembrane protein 87A-like [Lupinus angustifolius] OIW04333.1 hypothetical protein TanjilG_32525 [Lupinus angustifolius] Length = 548 Score = 76.3 bits (186), Expect = 1e-13 Identities = 36/47 (76%), Positives = 38/47 (80%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFNDSEDKFPTGKS 3 ASIHDYQNETFIHR+NSFFFHGGSEGLYAS ND+ED GKS Sbjct: 48 ASIHDYQNETFIHRSNSFFFHGGSEGLYASRVPYINDTEDNSLNGKS 94 >XP_015870342.1 PREDICTED: transmembrane protein 87A-like [Ziziphus jujuba] Length = 538 Score = 70.1 bits (170), Expect = 1e-11 Identities = 37/50 (74%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND---SEDKFPTGKS 3 ASIH+YQNETFI R+NSFFFHGGSEGLYAS S ND SEDK GKS Sbjct: 36 ASIHEYQNETFIRRSNSFFFHGGSEGLYASKRQSENDKPSSEDKPLNGKS 85 >XP_011469996.1 PREDICTED: transmembrane protein 87A-like [Fragaria vesca subsp. vesca] Length = 533 Score = 69.7 bits (169), Expect = 2e-11 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND---SEDKFPTGKS 3 ASIH+YQNETFI R+NSFFFHGGSEGLYAS S N+ SEDK GKS Sbjct: 32 ASIHEYQNETFIRRSNSFFFHGGSEGLYASRLHSHNEKLASEDKIIDGKS 81 >XP_009363789.1 PREDICTED: transmembrane protein 87B-like [Pyrus x bretschneideri] Length = 532 Score = 67.8 bits (164), Expect = 1e-10 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND---SEDKFPTGKS 3 ASIHDYQ+E+FI R+NSFFFHGGSEGLYAS S ND SEDK GKS Sbjct: 29 ASIHDYQDESFIRRSNSFFFHGGSEGLYASKLDSGNDKSSSEDKPLNGKS 78 >XP_009362785.1 PREDICTED: transmembrane protein 87A-like [Pyrus x bretschneideri] Length = 545 Score = 67.8 bits (164), Expect = 1e-10 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND---SEDKFPTGKS 3 ASIHDYQ+E+FI R+NSFFFHGGSEGLYAS S ND SEDK GKS Sbjct: 42 ASIHDYQDESFIRRSNSFFFHGGSEGLYASKLDSGNDKSSSEDKPLNGKS 91 >XP_008369378.1 PREDICTED: transmembrane protein 87A-like [Malus domestica] Length = 532 Score = 66.6 bits (161), Expect = 2e-10 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND---SEDKFPTGKS 3 ASIHDYQ+E+FI R+NSFFFHGGSEGLYAS S ND SED+ GKS Sbjct: 29 ASIHDYQDESFIRRSNSFFFHGGSEGLYASKLDSGNDKSSSEDRPLNGKS 78 >XP_017191784.1 PREDICTED: transmembrane protein 87A-like, partial [Malus domestica] Length = 490 Score = 64.7 bits (156), Expect = 1e-09 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND---SEDKFPTGKS 3 ASIHDYQ+E+FI R+NSFFFHGGSEGL AS S ND SEDK GKS Sbjct: 29 ASIHDYQDESFIRRSNSFFFHGGSEGLXASKLDSGNDKSSSEDKPLNGKS 78 >XP_008366805.1 PREDICTED: transmembrane protein 87A-like [Malus domestica] Length = 532 Score = 64.7 bits (156), Expect = 1e-09 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND---SEDKFPTGKS 3 ASIHDYQ+E+FI R+NSFFFHGGSEGL AS S ND SEDK GKS Sbjct: 29 ASIHDYQDESFIRRSNSFFFHGGSEGLXASKLDSGNDKSSSEDKPLNGKS 78 >KNA18399.1 hypothetical protein SOVF_071200 [Spinacia oleracea] Length = 534 Score = 62.4 bits (150), Expect = 7e-09 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -3 Query: 140 SIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFNDSEDKFPTGKS 3 SIHDY+NE FI ++N+FFFHGGSEGLYAS+ S + S +K G+S Sbjct: 36 SIHDYRNEKFIPQSNAFFFHGGSEGLYASMLSDHSSSSEKSSKGRS 81 >XP_008456965.1 PREDICTED: transmembrane protein 87A [Cucumis melo] Length = 539 Score = 62.4 bits (150), Expect = 7e-09 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 4/51 (7%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYAS----IPSSFNDSEDKFPTGKS 3 +SIH YQNE+FIHR+NSFFFHGGSEGLYAS + S+ DS + G S Sbjct: 35 SSIHQYQNESFIHRSNSFFFHGGSEGLYASNSHPLSSNSTDSAPQLLDGMS 85 >ONI24833.1 hypothetical protein PRUPE_2G264800 [Prunus persica] Length = 534 Score = 62.0 bits (149), Expect = 1e-08 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND---SEDKFPTGKS 3 ASIH+YQ+++FI R+NSFFFHGGSEGLYAS S N SEDK GKS Sbjct: 31 ASIHEYQDDSFIRRSNSFFFHGGSEGLYASKLDSDNGKSASEDKPLIGKS 80 >XP_015580566.1 PREDICTED: transmembrane protein 87B [Ricinus communis] Length = 515 Score = 61.2 bits (147), Expect = 2e-08 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYAS-IPSSFNDSEDKFPTGKS 3 ASIH YQNE FI R+N+FFFHGGSEGLYAS I S + S DK GKS Sbjct: 27 ASIHVYQNEAFIPRSNAFFFHGGSEGLYASRIHDSSSSSSDKPLHGKS 74 >KDO67540.1 hypothetical protein CISIN_1g042064mg [Citrus sinensis] Length = 276 Score = 60.1 bits (144), Expect = 3e-08 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 4/51 (7%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFND----SEDKFPTGKS 3 AS+H+Y NE FIHR+NS+FFHGGSEGLYAS D +EDK GKS Sbjct: 36 ASVHEYHNEGFIHRSNSYFFHGGSEGLYASKARIDADKPTSNEDKPINGKS 86 >XP_011076584.1 PREDICTED: transmembrane protein 87A-like [Sesamum indicum] Length = 513 Score = 60.5 bits (145), Expect = 3e-08 Identities = 32/52 (61%), Positives = 37/52 (71%), Gaps = 5/52 (9%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYAS----IPSSFNDSEDKFP-TGKS 3 ASIH+Y NE FI R NSFFFHGGSEGLYAS P + +D ++ P TGKS Sbjct: 13 ASIHEYNNEAFIPRFNSFFFHGGSEGLYASKNRDTPGATHDDDNSKPLTGKS 64 >XP_019224647.1 PREDICTED: transmembrane protein 87B-like [Nicotiana attenuata] OIT33203.1 hypothetical protein A4A49_07226 [Nicotiana attenuata] Length = 530 Score = 60.5 bits (145), Expect = 3e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFNDSEDKFPTGKS 3 ASIH+Y+NE FI ++N+FFFHGG+EGLYAS SS N S DK GKS Sbjct: 28 ASIHEYKNEQFIPKSNAFFFHGGTEGLYAS-KSSSNASPDKPLEGKS 73 >XP_010252050.1 PREDICTED: transmembrane protein 87B [Nelumbo nucifera] Length = 535 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = -3 Query: 143 ASIHDYQNETFIHRANSFFFHGGSEGLYASIPSSFNDSEDKFPTGKS 3 ASIH+Y+NE F ++NSFFFHGGSEGLYAS SEDK GKS Sbjct: 36 ASIHEYRNEAFASQSNSFFFHGGSEGLYASKVHDKATSEDKPYNGKS 82