BLASTX nr result
ID: Glycyrrhiza28_contig00021063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00021063 (334 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024582430.1 hypothetical protein [Bradyrhizobium elkanii] OCX... 56 8e-07 WP_051404307.1 hypothetical protein [Bradyrhizobium sp. OHSU_III] 56 8e-07 >WP_024582430.1 hypothetical protein [Bradyrhizobium elkanii] OCX28629.1 hypothetical protein QU42_21445 [Bradyrhizobium sp. UASWS1016] Length = 330 Score = 55.8 bits (133), Expect = 8e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 ASVMEQARSAYRHGDSSRNVFYGFRVARPL 92 AS M QARSAYRHGD SR +FYGFRVARPL Sbjct: 301 ASAMNQARSAYRHGDGSRTIFYGFRVARPL 330 >WP_051404307.1 hypothetical protein [Bradyrhizobium sp. OHSU_III] Length = 337 Score = 55.8 bits (133), Expect = 8e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 ASVMEQARSAYRHGDSSRNVFYGFRVARPL 92 AS M QARSAYRHGD SR +FYGFRVARPL Sbjct: 308 ASAMNQARSAYRHGDGSRTIFYGFRVARPL 337