BLASTX nr result
ID: Glycyrrhiza28_contig00020938
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020938 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019449980.1 PREDICTED: uncharacterized TPR repeat-containing ... 54 1e-06 >XP_019449980.1 PREDICTED: uncharacterized TPR repeat-containing protein At1g05150-like [Lupinus angustifolius] OIW07662.1 hypothetical protein TanjilG_07704 [Lupinus angustifolius] Length = 799 Score = 53.9 bits (128), Expect = 1e-06 Identities = 33/60 (55%), Positives = 35/60 (58%) Frame = +1 Query: 61 TYEGLLRTYXXXXXXXXXXXXXXXXXXXXXXXXKAPPPVSEASTSSIVDERMALETQKKQ 240 TYEGLLRTY KAPP VSEAS+SSIVDERMA+ETQKKQ Sbjct: 72 TYEGLLRTYDDGAGDVDRDYDALGLELNFDD--KAPPHVSEASSSSIVDERMAVETQKKQ 129