BLASTX nr result
ID: Glycyrrhiza28_contig00020823
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020823 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_028152394.1 MULTISPECIES: ArdC antirestriction protein [Brady... 65 1e-21 WP_041578066.1 hypothetical protein [Xanthobacter autotrophicus] 72 2e-21 WP_069694177.1 antirestriction protein ArdC [Bosea vaviloviae] A... 64 2e-19 WP_071208317.1 antirestriction protein ArdC [Agrobacterium vitis... 62 3e-19 WP_071204369.1 antirestriction protein ArdC [Agrobacterium vitis... 62 3e-19 WP_012648960.1 antirestriction protein [Agrobacterium vitis] ACM... 62 3e-19 WP_049819866.1 hypothetical protein [Bradyrhizobium japonicum] 67 6e-19 WP_077548973.1 antirestriction protein ArdC [Rhizobium flavum] 62 8e-19 WP_059188849.1 hypothetical protein [Mesorhizobium loti] KUM2442... 64 1e-18 WP_054209607.1 antirestriction protein ArdC [Bosea vaviloviae] K... 61 1e-18 SCB50472.1 Antirestriction protein ArdC [Rhizobium multihospitium] 64 2e-18 WP_066877911.1 antirestriction protein ArdC [Sinorhizobium sahel... 62 2e-18 WP_007636204.1 hypothetical protein [Rhizobium sp. CCGE 510] EJT... 64 3e-18 WP_057193835.1 antirestriction protein ArdC [Bosea sp. Root483D1... 67 4e-18 WP_054164264.1 antirestriction protein ArdC [Rhodopseudomonas sp... 63 4e-18 WP_012477326.1 hypothetical protein [Sinorhizobium meliloti] YP_... 65 4e-18 WP_035031923.1 ArdC antirestriction protein [Aquamicrobium deflu... 62 5e-18 ODT77254.1 antirestriction protein ArdC [Pelagibacterium sp. SCN... 67 6e-18 WP_046135096.1 ArdC antirestriction protein [Devosia limi] KKB84... 67 6e-18 WP_027512945.1 ArdC antirestriction protein [Rhizobium sullae] 60 6e-18 >WP_028152394.1 MULTISPECIES: ArdC antirestriction protein [Bradyrhizobium] Length = 306 Score = 65.1 bits (157), Expect(2) = 1e-21 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 +AEIG+AL+CADLGIVPELEPRPDHAAY ASW+ Sbjct: 236 LAEIGSALVCADLGIVPELEPRPDHAAYVASWI 268 Score = 65.1 bits (157), Expect(2) = 1e-21 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +LSNDRR FSAAAHAQRAVAYLHSLQP+AE+E+EAA Sbjct: 270 VLSNDRRAIFSAAAHAQRAVAYLHSLQPKAENEQEAA 306 >WP_041578066.1 hypothetical protein [Xanthobacter autotrophicus] Length = 90 Score = 71.6 bits (174), Expect(2) = 2e-21 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 15 SGYVAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 SGY+AEIG+AL+CADLGIVPELEPRPDHAAY SWL Sbjct: 18 SGYIAEIGSALLCADLGIVPELEPRPDHAAYLGSWL 53 Score = 58.2 bits (139), Expect(2) = 2e-21 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 121 SILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREA 231 S+LSND+R F+AAAHAQRAVAYLH LQPQAE+ + A Sbjct: 54 SVLSNDKRAIFAAAAHAQRAVAYLHGLQPQAETVKAA 90 >WP_069694177.1 antirestriction protein ArdC [Bosea vaviloviae] AOO84994.1 antirestriction protein ArdC (plasmid) [Bosea vaviloviae] Length = 308 Score = 63.5 bits (153), Expect(2) = 2e-19 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 VAEIG+AL+CADLGIVPELE RPDHAAY ASWL Sbjct: 238 VAEIGSALLCADLGIVPELELRPDHAAYVASWL 270 Score = 59.7 bits (143), Expect(2) = 2e-19 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +LS+D+R F AAAHAQRAVAYLH LQP++E+EREAA Sbjct: 272 VLSDDKRAIFQAAAHAQRAVAYLHGLQPESEAEREAA 308 >WP_071208317.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ40520.1 antirestriction protein ArdC [Agrobacterium vitis] Length = 308 Score = 62.0 bits (149), Expect(2) = 3e-19 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 27 AEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 A+IGA+ +CADLGIVPELEPRPDHA+Y ASWL Sbjct: 239 ADIGASFLCADLGIVPELEPRPDHASYVASWL 270 Score = 60.1 bits (144), Expect(2) = 3e-19 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +L DRR F AAAHAQRAVAYLH+LQPQA++EREAA Sbjct: 272 LLEGDRRAIFQAAAHAQRAVAYLHALQPQADTEREAA 308 >WP_071204369.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ20675.1 antirestriction protein ArdC [Agrobacterium vitis] Length = 308 Score = 62.0 bits (149), Expect(2) = 3e-19 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 27 AEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 A+IGA+ +CADLGIVPELEPRPDHA+Y ASWL Sbjct: 239 ADIGASFLCADLGIVPELEPRPDHASYVASWL 270 Score = 60.1 bits (144), Expect(2) = 3e-19 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +L DRR F AAAHAQRAVAYLH+LQPQA++EREAA Sbjct: 272 LLEGDRRAIFQAAAHAQRAVAYLHALQPQADTEREAA 308 >WP_012648960.1 antirestriction protein [Agrobacterium vitis] ACM39594.1 antirestriction protein (plasmid) [Agrobacterium vitis S4] OHZ16572.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ38549.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ38720.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ43583.1 antirestriction protein ArdC [Agrobacterium vitis] Length = 308 Score = 62.0 bits (149), Expect(2) = 3e-19 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 27 AEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 A+IGA+ +CADLGIVPELEPRPDHA+Y ASWL Sbjct: 239 ADIGASFLCADLGIVPELEPRPDHASYVASWL 270 Score = 60.1 bits (144), Expect(2) = 3e-19 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +L DRR F AAAHAQRAVAYLH+LQPQA++EREAA Sbjct: 272 LLEGDRRAIFQAAAHAQRAVAYLHALQPQADTEREAA 308 >WP_049819866.1 hypothetical protein [Bradyrhizobium japonicum] Length = 91 Score = 66.6 bits (161), Expect(2) = 6e-19 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +3 Query: 15 SGYVAEIGAALMCADLGIVPELEPRPDHAAYAASWLD 125 SGY+AE+G+ +CADLGI PELEPRPDHA+Y ASWL+ Sbjct: 18 SGYIAELGSCFLCADLGISPELEPRPDHASYLASWLE 54 Score = 54.7 bits (130), Expect(2) = 6e-19 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +LSN++R FSAAAHAQRAVAYLH LQP+A EAA Sbjct: 55 VLSNEKRFIFSAAAHAQRAVAYLHDLQPKAADVEEAA 91 >WP_077548973.1 antirestriction protein ArdC [Rhizobium flavum] Length = 308 Score = 61.6 bits (148), Expect(2) = 8e-19 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 27 AEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 A+IGA +CADLGIVPELEPRPDHA+Y ASWL Sbjct: 239 ADIGACFLCADLGIVPELEPRPDHASYVASWL 270 Score = 59.3 bits (142), Expect(2) = 8e-19 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +L DRR F AAAHAQRAVAYLH LQP+AE+EREAA Sbjct: 272 LLEGDRRAIFQAAAHAQRAVAYLHDLQPKAETEREAA 308 >WP_059188849.1 hypothetical protein [Mesorhizobium loti] KUM24429.1 hypothetical protein AU467_30400 [Mesorhizobium loti] Length = 91 Score = 64.3 bits (155), Expect(2) = 1e-18 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 15 SGYVAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 SGYVAE+G+ +CADLGI PELEPRPDHA+Y SWL Sbjct: 18 SGYVAELGSCFVCADLGIAPELEPRPDHASYLDSWL 53 Score = 56.2 bits (134), Expect(2) = 1e-18 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +L++D+R FSAAAHAQRAVA+LH LQP A EREAA Sbjct: 55 VLADDKRAIFSAAAHAQRAVAFLHGLQPAASEEREAA 91 >WP_054209607.1 antirestriction protein ArdC [Bosea vaviloviae] KPH80353.1 ArdC antirestriction protein [Bosea vaviloviae] Length = 308 Score = 60.8 bits (146), Expect(2) = 1e-18 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 +AE+G+ +CADLG+VPELEPRPDHA+Y ASWL Sbjct: 238 IAELGSCFLCADLGLVPELEPRPDHASYLASWL 270 Score = 59.3 bits (142), Expect(2) = 1e-18 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +LSND+R FSAAAHAQRAVAYLHSLQP+A S EAA Sbjct: 272 VLSNDKRFIFSAAAHAQRAVAYLHSLQPEASSIAEAA 308 >SCB50472.1 Antirestriction protein ArdC [Rhizobium multihospitium] Length = 309 Score = 63.9 bits (154), Expect(2) = 2e-18 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWLDSFQ 134 VAEIG+AL+CADLGIVPELEPRP+HA+Y SWL Q Sbjct: 239 VAEIGSALLCADLGIVPELEPRPEHASYVQSWLQVLQ 275 Score = 55.8 bits (133), Expect(2) = 2e-18 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +L D+R F AAAHAQRA A+LHSLQP++E+EREAA Sbjct: 273 VLQGDKRAIFQAAAHAQRAAAFLHSLQPKSEAEREAA 309 >WP_066877911.1 antirestriction protein ArdC [Sinorhizobium saheli] OAP39707.1 antirestriction protein ArdC [Sinorhizobium saheli] Length = 308 Score = 61.6 bits (148), Expect(2) = 2e-18 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 27 AEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 A+IGA+ +CADLGIVPELEPRPDHA+Y ASWL Sbjct: 239 ADIGASFICADLGIVPELEPRPDHASYVASWL 270 Score = 58.2 bits (139), Expect(2) = 2e-18 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +L DRR F AAAHAQRAVAYLH LQPQAE+ REAA Sbjct: 272 LLDGDRRAIFQAAAHAQRAVAYLHDLQPQAETGREAA 308 >WP_007636204.1 hypothetical protein [Rhizobium sp. CCGE 510] EJT01424.1 hypothetical protein RCCGE510_29266 [Rhizobium sp. CCGE 510] Length = 308 Score = 63.5 bits (153), Expect(2) = 3e-18 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 +AEIG+ L+CADLGIVPELEPRPDHA+Y ASWL Sbjct: 238 IAEIGSCLVCADLGIVPELEPRPDHASYLASWL 270 Score = 55.5 bits (132), Expect(2) = 3e-18 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +LS+D+R F AAAHAQRAVA+LHSLQP EREAA Sbjct: 272 VLSDDKRAIFQAAAHAQRAVAFLHSLQPAVTEEREAA 308 >WP_057193835.1 antirestriction protein ArdC [Bosea sp. Root483D1] KRE11787.1 antirestriction protein ArdC [Bosea sp. Root483D1] Length = 308 Score = 66.6 bits (161), Expect(2) = 4e-18 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 VAEIG+AL+CADLGIVPELEPRPDHAAY ASWL Sbjct: 238 VAEIGSALVCADLGIVPELEPRPDHAAYIASWL 270 Score = 52.0 bits (123), Expect(2) = 4e-18 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 127 LSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 L++D+R F AAAHAQRAV YLH LQ + E+EREAA Sbjct: 273 LADDKRAIFKAAAHAQRAVTYLHGLQQEPEAEREAA 308 >WP_054164264.1 antirestriction protein ArdC [Rhodopseudomonas sp. AAP120] KPF95045.1 antirestriction protein ArdC [Rhodopseudomonas sp. AAP120] Length = 308 Score = 62.8 bits (151), Expect(2) = 4e-18 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWLD 125 VAE+GA +CADL IVPELEPRPDHA+Y ASWLD Sbjct: 238 VAELGACFLCADLDIVPELEPRPDHASYLASWLD 271 Score = 55.8 bits (133), Expect(2) = 4e-18 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +1 Query: 124 ILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +LSND+R FSAAAHAQRAVAYLH LQP + REAA Sbjct: 272 VLSNDKRFIFSAAAHAQRAVAYLHGLQPDSGMVREAA 308 >WP_012477326.1 hypothetical protein [Sinorhizobium meliloti] YP_001965631.1 hypothetical protein [Sinorhizobium meliloti SM11] ABN47138.1 hypothetical protein (plasmid) [Sinorhizobium meliloti SM11] CDH81127.1 antirestriction protein [Sinorhizobium meliloti RU11/001] Length = 84 Score = 65.1 bits (157), Expect(2) = 4e-18 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 15 SGYVAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 SGYVAE+G+ +CADLGI PELEPRPDHA+Y SWL Sbjct: 12 SGYVAELGSCFLCADLGIAPELEPRPDHASYLQSWL 47 Score = 53.5 bits (127), Expect(2) = 4e-18 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +1 Query: 121 SILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREA 231 S+L+ND+R F +AAHAQRAVAYLHSLQP+A+ + A Sbjct: 48 SVLANDKRAIFQSAAHAQRAVAYLHSLQPEADLKAAA 84 >WP_035031923.1 ArdC antirestriction protein [Aquamicrobium defluvii] EXL02088.1 ArdC antirestriction protein [Aquamicrobium defluvii] EZQ12932.1 ArdC antirestriction protein [Pseudomonas bauzanensis] Length = 309 Score = 62.4 bits (150), Expect(2) = 5e-18 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 27 AEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 AEIG+AL+CADLGIVPELEPRPDHAAY SW+ Sbjct: 240 AEIGSALVCADLGIVPELEPRPDHAAYLQSWM 271 Score = 55.8 bits (133), Expect(2) = 5e-18 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +1 Query: 121 SILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 ++L+ND+R F AAAHAQRAV YLH LQP A EREAA Sbjct: 272 TVLANDKRAIFQAAAHAQRAVNYLHGLQPVASEEREAA 309 >ODT77254.1 antirestriction protein ArdC [Pelagibacterium sp. SCN 64-44] Length = 309 Score = 67.0 bits (162), Expect(2) = 6e-18 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 VAEIG+AL+CADLGIVPELEPRPDHAAY ASWL Sbjct: 239 VAEIGSALLCADLGIVPELEPRPDHAAYLASWL 271 Score = 50.8 bits (120), Expect(2) = 6e-18 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +1 Query: 121 SILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 ++L++D+R F AAAHAQRAV YLH+LQP E EAA Sbjct: 272 TVLADDKRAIFQAAAHAQRAVNYLHALQPAVAEEHEAA 309 >WP_046135096.1 ArdC antirestriction protein [Devosia limi] KKB84634.1 ArdC antirestriction protein [Devosia limi DSM 17137] SHF56297.1 Antirestriction protein ArdC [Devosia limi DSM 17137] Length = 309 Score = 67.0 bits (162), Expect(2) = 6e-18 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWL 122 VAEIG+AL+CADLGIVPELEPRPDHAAY ASWL Sbjct: 239 VAEIGSALLCADLGIVPELEPRPDHAAYLASWL 271 Score = 50.8 bits (120), Expect(2) = 6e-18 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +1 Query: 121 SILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 ++L++D+R F AAAHAQRAV YLH+LQP E EAA Sbjct: 272 TVLADDKRAIFQAAAHAQRAVNYLHALQPAVAEEHEAA 309 >WP_027512945.1 ArdC antirestriction protein [Rhizobium sullae] Length = 308 Score = 60.5 bits (145), Expect(2) = 6e-18 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +3 Query: 24 VAEIGAALMCADLGIVPELEPRPDHAAYAASWLDSFQ 134 VAE+G+ +CADLG+VPELEPRPDHA+Y SWL Q Sbjct: 238 VAELGSCFLCADLGVVPELEPRPDHASYLQSWLTVIQ 274 Score = 57.4 bits (137), Expect(2) = 6e-18 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +1 Query: 121 SILSNDRRVTFSAAAHAQRAVAYLHSLQPQAESEREAA 234 +++ ND+R F+AAAHAQRAV YLH+LQP+AE+ER+AA Sbjct: 271 TVIQNDQRAIFAAAAHAQRAVDYLHALQPKAETERQAA 308