BLASTX nr result
ID: Glycyrrhiza28_contig00020707
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020707 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU20081.1 hypothetical protein TSUD_381730 [Trifolium subterran... 65 2e-10 GAU21439.1 hypothetical protein TSUD_32700 [Trifolium subterraneum] 63 6e-10 GAU20082.1 hypothetical protein TSUD_381740 [Trifolium subterran... 64 7e-10 XP_003599631.2 F-box protein interaction domain protein [Medicag... 63 2e-09 XP_003598106.2 F-box protein interaction domain protein [Medicag... 63 2e-09 GAU20086.1 hypothetical protein TSUD_381780 [Trifolium subterran... 63 2e-09 GAU20084.1 hypothetical protein TSUD_381760 [Trifolium subterran... 62 3e-09 XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 62 3e-09 XP_004486105.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 62 5e-09 XP_013458818.1 F-box protein interaction domain protein [Medicag... 62 5e-09 GAU16390.1 hypothetical protein TSUD_117390 [Trifolium subterran... 62 5e-09 GAU20092.1 hypothetical protein TSUD_381840 [Trifolium subterran... 61 6e-09 XP_003618781.1 F-box protein interaction domain protein [Medicag... 61 6e-09 XP_003598377.1 F-box protein interaction domain protein [Medicag... 61 6e-09 XP_003598388.1 F-box and associated interaction domain protein [... 61 9e-09 XP_003614689.2 F-box protein interaction domain protein [Medicag... 61 9e-09 XP_003614663.2 F-box protein interaction domain protein [Medicag... 61 1e-08 XP_003614662.1 F-box protein interaction domain protein [Medicag... 60 1e-08 GAU29626.1 hypothetical protein TSUD_164760 [Trifolium subterran... 60 1e-08 XP_003614687.1 F-box protein interaction domain protein [Medicag... 60 1e-08 >GAU20081.1 hypothetical protein TSUD_381730 [Trifolium subterraneum] Length = 300 Score = 65.1 bits (157), Expect = 2e-10 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 177 VEILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 VEIL RLP+KSL++ + VCKSW SLISDPKFAKKHLRV Sbjct: 74 VEILSRLPMKSLMQFQCVCKSWKSLISDPKFAKKHLRV 111 >GAU21439.1 hypothetical protein TSUD_32700 [Trifolium subterraneum] Length = 230 Score = 63.2 bits (152), Expect = 6e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHL 284 EIL RLPVK LL++R VCKSWNSLISDP+FAKKHL Sbjct: 25 EILSRLPVKFLLQIRCVCKSWNSLISDPRFAKKHL 59 >GAU20082.1 hypothetical protein TSUD_381740 [Trifolium subterraneum] Length = 391 Score = 63.9 bits (154), Expect = 7e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 177 VEILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 VEIL +LP+KSL++ + VCKSW SLISDPKFAKKHLRV Sbjct: 51 VEILSKLPMKSLMQFQCVCKSWKSLISDPKFAKKHLRV 88 >XP_003599631.2 F-box protein interaction domain protein [Medicago truncatula] AES69882.2 F-box protein interaction domain protein [Medicago truncatula] Length = 345 Score = 62.8 bits (151), Expect = 2e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 EIL RLPVKSLL+ R VCKSW SLISDPKFAKKHL + Sbjct: 27 EILCRLPVKSLLQFRCVCKSWKSLISDPKFAKKHLHM 63 >XP_003598106.2 F-box protein interaction domain protein [Medicago truncatula] AES68357.2 F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 62.8 bits (151), Expect = 2e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHL 284 EIL RLPVK LL+LR CKSWNSLISDPKFAKKHL Sbjct: 55 EILSRLPVKLLLQLRCSCKSWNSLISDPKFAKKHL 89 >GAU20086.1 hypothetical protein TSUD_381780 [Trifolium subterraneum] Length = 406 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 EIL +LPVK L++L++VCK W SLISDPKFAKKHLRV Sbjct: 55 EILSKLPVKFLMQLQFVCKPWKSLISDPKFAKKHLRV 91 >GAU20084.1 hypothetical protein TSUD_381760 [Trifolium subterraneum] Length = 421 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 EIL +LPVKSL++ + VCKSW SLISDPKFAKKHLR+ Sbjct: 67 EILSKLPVKSLMQFQCVCKSWKSLISDPKFAKKHLRM 103 >XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 405 Score = 62.0 bits (149), Expect = 3e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 EIL RLPVK L++LR VCKSW SLI DPKF KKHLRV Sbjct: 55 EILSRLPVKILMQLRCVCKSWKSLICDPKFVKKHLRV 91 >XP_004486105.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 384 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 177 VEILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 +EIL RLPVK L++L+ VCKSW SLISDPKFAK HLR+ Sbjct: 35 IEILSRLPVKFLIQLQCVCKSWKSLISDPKFAKMHLRM 72 >XP_013458818.1 F-box protein interaction domain protein [Medicago truncatula] KEH32860.1 F-box protein interaction domain protein [Medicago truncatula] Length = 385 Score = 61.6 bits (148), Expect = 5e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 EIL RLPVK LL+LR VCKSWNSLISD KFA KHLR+ Sbjct: 43 EILTRLPVKLLLQLRSVCKSWNSLISDSKFAMKHLRL 79 >GAU16390.1 hypothetical protein TSUD_117390 [Trifolium subterraneum] Length = 633 Score = 61.6 bits (148), Expect = 5e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 EIL RLPVK LL+LR +CKSWNSLISDPKFA KHL + Sbjct: 331 EILCRLPVKLLLQLRCICKSWNSLISDPKFATKHLHM 367 >GAU20092.1 hypothetical protein TSUD_381840 [Trifolium subterraneum] Length = 367 Score = 61.2 bits (147), Expect = 6e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 EIL +LPVK L++L+ VCKSW SLIS+PKFAKKHLRV Sbjct: 37 EILSKLPVKFLMQLKSVCKSWKSLISNPKFAKKHLRV 73 >XP_003618781.1 F-box protein interaction domain protein [Medicago truncatula] AES74999.1 F-box protein interaction domain protein [Medicago truncatula] Length = 382 Score = 61.2 bits (147), Expect = 6e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +3 Query: 177 VEILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 +EIL RLPVKSLL LR VCKS NS+ISDPKFAK HLR+ Sbjct: 26 LEILHRLPVKSLLTLRCVCKSLNSIISDPKFAKDHLRL 63 >XP_003598377.1 F-box protein interaction domain protein [Medicago truncatula] AES68628.1 F-box protein interaction domain protein [Medicago truncatula] Length = 382 Score = 61.2 bits (147), Expect = 6e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 EIL RLPVK L++LRYVCK +NSLISDPKF KKHLR+ Sbjct: 51 EILCRLPVKLLIQLRYVCKLFNSLISDPKFVKKHLRM 87 >XP_003598388.1 F-box and associated interaction domain protein [Medicago truncatula] AES68639.1 F-box and associated interaction domain protein [Medicago truncatula] Length = 389 Score = 60.8 bits (146), Expect = 9e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLRV 290 +IL RL VK LL+LR VCKSW SLISDPKFAKKHLR+ Sbjct: 35 DILSRLQVKFLLQLRCVCKSWKSLISDPKFAKKHLRL 71 >XP_003614689.2 F-box protein interaction domain protein [Medicago truncatula] AES97647.2 F-box protein interaction domain protein [Medicago truncatula] Length = 397 Score = 60.8 bits (146), Expect = 9e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLR 287 EIL RLPVK L++ R VCK WNSLISDPKFAKKH R Sbjct: 53 EILHRLPVKPLMQFRCVCKWWNSLISDPKFAKKHFR 88 >XP_003614663.2 F-box protein interaction domain protein [Medicago truncatula] AES97621.2 F-box protein interaction domain protein [Medicago truncatula] Length = 1041 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLR 287 EIL RLPVK L++ R VCK WNSLISDPKFAKKH R Sbjct: 53 EILHRLPVKPLMQFRCVCKWWNSLISDPKFAKKHFR 88 >XP_003614662.1 F-box protein interaction domain protein [Medicago truncatula] AES97620.1 F-box protein interaction domain protein [Medicago truncatula] Length = 347 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLR 287 EIL RLPVK L++ R VCK WNSLISDPKFAKKH R Sbjct: 53 EILYRLPVKPLMQFRCVCKWWNSLISDPKFAKKHFR 88 >GAU29626.1 hypothetical protein TSUD_164760 [Trifolium subterraneum] Length = 356 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHL 284 +IL RLPVK LL+ + VCKSWNSLISDPKFAKKHL Sbjct: 27 KILSRLPVKLLLQFQCVCKSWNSLISDPKFAKKHL 61 >XP_003614687.1 F-box protein interaction domain protein [Medicago truncatula] AES97645.1 F-box protein interaction domain protein [Medicago truncatula] Length = 386 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 180 EILQRLPVKSLLRLRYVCKSWNSLISDPKFAKKHLR 287 EIL RLPVK L++ R VCK WNSLISDPKFAKKH R Sbjct: 53 EILYRLPVKPLMQFRCVCKWWNSLISDPKFAKKHFR 88