BLASTX nr result
ID: Glycyrrhiza28_contig00020647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020647 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ALF37644.1 putative reverse transcriptase [Strawberry vein bandi... 64 3e-10 AKB94071.1 ORF V protein [Strawberry vein banding virus] 64 3e-10 CCG14716.1 ORF V protein [Strawberry vein banding virus] 64 3e-10 NP_043933.1 hypothetical protein [Strawberry vein banding virus]... 63 4e-10 YP_009182100.1 polyprotein [Blueberry fruit drop associated viru... 64 8e-10 AMN10080.1 reverse transcriptase [Angelica bushy stunt virus] 57 3e-09 NP_612577.1 Enzymatic polyprotein [Contains: Aspartic protease; ... 55 1e-08 YP_001931961.1 replicase [Lamium leaf distortion virus] ACB69767... 58 2e-08 YP_006607892.1 reverse transcriptase [Soybean Putnam virus] AFP9... 58 2e-08 YP_009165750.1 ORF5 [Atractylodes mild mottle virus] ALD49090.1 ... 59 3e-08 NP_659397.1 hypothetical protein [Mirabilis mosaic virus] AAM531... 58 6e-08 CAH68829.1 polyprotein [Carnation etched ring virus] 53 6e-08 BAS06276.1 polymerase polyprotein [Dahlia common mosaic virus] 58 8e-08 AEL30041.1 polymerase polyprotein [Dahlia common mosaic virus] 58 8e-08 ABW81763.1 reverse transcriptase [Dahlia mosaic virus-Holland] 58 8e-08 YP_006907834.1 polyprotein [Horseradish latent virus] AAW56089.1... 58 8e-08 AGQ49469.1 reverse transcriptase [Dahlia mosaic virus] 56 1e-07 YP_002519387.1 putative enzymatic polyprotein [Rudbeckia flower ... 52 1e-07 BAO53526.1 reverse transcriptase [Cauliflower mosaic virus] 57 2e-07 AHA91342.1 reverse transcriptase [Cauliflower mosaic virus] AHA9... 57 2e-07 >ALF37644.1 putative reverse transcriptase [Strawberry vein banding virus] Length = 704 Score = 63.5 bits (153), Expect(2) = 3e-10 Identities = 29/59 (49%), Positives = 45/59 (76%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYVL 258 AS++ WG+V+KAK P + KE++CRY SGTF +E NY ++EKE L++I+ ++ R Y+L Sbjct: 581 ASDDHWGAVLKAKLP-EGKEVICRYASGTFKPAEKNYHSNEKEILSIIKAIKAFRAYIL 638 Score = 28.5 bits (62), Expect(2) = 3e-10 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K+K L K LP LY+PS ++ IIE + Sbjct: 555 KIKSLVKSLPDLYNPSPEDKPIIECD 580 >AKB94071.1 ORF V protein [Strawberry vein banding virus] Length = 704 Score = 63.5 bits (153), Expect(2) = 3e-10 Identities = 29/59 (49%), Positives = 45/59 (76%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYVL 258 AS++ WG+V+KAK P + KE++CRY SGTF +E NY ++EKE L++I+ ++ R Y+L Sbjct: 581 ASDDHWGAVLKAKLP-EGKEVICRYASGTFKPAEKNYHSNEKEILSIIKAIKAFRAYIL 638 Score = 28.5 bits (62), Expect(2) = 3e-10 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K+K L K LP LY+PS ++ IIE + Sbjct: 555 KIKSLVKSLPDLYNPSPEDRPIIECD 580 >CCG14716.1 ORF V protein [Strawberry vein banding virus] Length = 699 Score = 63.5 bits (153), Expect(2) = 3e-10 Identities = 29/59 (49%), Positives = 45/59 (76%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYVL 258 AS++ WG+V+KAK P + KE++CRY SGTF +E NY ++EKE L++I+ ++ R Y+L Sbjct: 576 ASDDHWGAVLKAKLP-EGKEVICRYASGTFKPAEKNYHSNEKEILSIIKAIKAFRAYIL 633 Score = 28.5 bits (62), Expect(2) = 3e-10 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K+K L K LP LY+PS ++ IIE + Sbjct: 550 KIKSLVKSLPDLYNPSPEDKPIIECD 575 >NP_043933.1 hypothetical protein [Strawberry vein banding virus] CAA65970.1 ORF V [Strawberry vein banding virus] Length = 708 Score = 63.2 bits (152), Expect(2) = 4e-10 Identities = 28/59 (47%), Positives = 45/59 (76%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYVL 258 AS++ WG+++KAK P + KE++CRY SGTF +E NY ++EKE L++I+ ++ R Y+L Sbjct: 585 ASDDHWGAILKAKLP-EGKEVICRYASGTFKPAEKNYHSNEKEILSIIKAIKAFRAYIL 642 Score = 28.1 bits (61), Expect(2) = 4e-10 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K+K L K LP LY+PS ++ IIE + Sbjct: 559 KIKSLVKTLPDLYNPSPEDKPIIECD 584 >YP_009182100.1 polyprotein [Blueberry fruit drop associated virus] ALN12435.1 polyprotein [Blueberry fruit drop associated virus] Length = 2597 Score = 63.5 bits (153), Expect = 8e-10 Identities = 29/59 (49%), Positives = 41/59 (69%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYVL 258 AS+ W + A SP +K+E++C Y SGTF +E NY T EKE LA+IR ++K +I+VL Sbjct: 2005 ASDHHWAGTIGAISPDKKEEVICAYRSGTFKPAEQNYSTQEKEVLAIIRTIQKAKIFVL 2063 >AMN10080.1 reverse transcriptase [Angelica bushy stunt virus] Length = 703 Score = 56.6 bits (135), Expect(2) = 3e-09 Identities = 26/58 (44%), Positives = 41/58 (70%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS + WG ++KA + + EL+CRY SG+F +E Y ++EKE LA+IR+++K IY+ Sbjct: 580 ASQDYWGGILKAANTNGE-ELICRYASGSFKSAETRYHSNEKEYLAVIRVIKKFSIYL 636 Score = 31.6 bits (70), Expect(2) = 3e-09 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 KLK + PKLYHP D+ +IIET+ Sbjct: 554 KLKKGLNNFPKLYHPLPDDKLIIETD 579 >NP_612577.1 Enzymatic polyprotein [Contains: Aspartic protease; Endonuclease; Reverse transcriptase] [Carnation etched ring virus] P05400.1 RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase CAA28360.1 unnamed protein product [Carnation etched ring virus] prf||1301227E ORF 5 Length = 659 Score = 55.5 bits (132), Expect(2) = 1e-08 Identities = 27/58 (46%), Positives = 39/58 (67%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS E WG ++KA E +CRY SG+F +E NY ++EKE LA+IR+++K IY+ Sbjct: 536 ASEEFWGGILKAIH--NSHEYICRYASGSFKAAERNYHSNEKELLAVIRVIKKFSIYL 591 Score = 31.2 bits (69), Expect(2) = 1e-08 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K+K K PKLYHP ++ ++IET+ Sbjct: 510 KIKKNLKSFPKLYHPEPNDKLVIETD 535 >YP_001931961.1 replicase [Lamium leaf distortion virus] ACB69767.1 replicase [Lamium leaf distortion virus] Length = 696 Score = 57.8 bits (138), Expect(2) = 2e-08 Identities = 27/58 (46%), Positives = 41/58 (70%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS + WG ++KA Q +E +CRY SG+F +E+NY ++EKE LA+IR++ K IY+ Sbjct: 570 ASGKYWGGILKAIH--QSEERICRYTSGSFKKAELNYHSNEKEILAVIRVIAKFTIYL 625 Score = 28.1 bits (61), Expect(2) = 2e-08 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 ++K D PKL+HP+ D +IIE + Sbjct: 544 EIKKSLTDFPKLHHPATDEKLIIECD 569 >YP_006607892.1 reverse transcriptase [Soybean Putnam virus] AFP95350.1 reverse transcriptase [Soybean Putnam virus] Length = 699 Score = 57.8 bits (138), Expect(2) = 2e-08 Identities = 24/58 (41%), Positives = 39/58 (67%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS WG ++KA++ EL+CRY SG+F +E+NY ++EKE LA++ ++K Y+ Sbjct: 577 ASGSFWGGILKARTENSDSELICRYTSGSFKAAELNYHSNEKEILAVMNTIKKFTGYL 634 Score = 27.7 bits (60), Expect(2) = 2e-08 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K+K K P LYHP + +IIET+ Sbjct: 551 KIKKNLKSFPTLYHPKLTDTLIIETD 576 >YP_009165750.1 ORF5 [Atractylodes mild mottle virus] ALD49090.1 ORF5 [Atractylodes mild mottle virus] Length = 679 Score = 58.9 bits (141), Expect = 3e-08 Identities = 25/58 (43%), Positives = 40/58 (68%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS+ WG ++KAK+ + KE +CRY SG+F +E+NY ++EKE LA + ++K Y+ Sbjct: 557 ASDSFWGGILKAKTIDEDKEYICRYTSGSFKQAELNYHSNEKEILAAMNTIKKFSGYL 614 >NP_659397.1 hypothetical protein [Mirabilis mosaic virus] AAM53128.1 ORFV [Mirabilis mosaic virus] Length = 674 Score = 58.2 bits (139), Expect = 6e-08 Identities = 27/58 (46%), Positives = 43/58 (74%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS+ WG V+KA++ + +EL+CRY SGTF +E+NY ++EKE LA+ +++ K IY+ Sbjct: 545 ASDHFWGGVLKAQTT-EGEELICRYSSGTFKPAELNYHSNEKELLAVKQVITKFSIYL 601 >CAH68829.1 polyprotein [Carnation etched ring virus] Length = 656 Score = 52.8 bits (125), Expect(2) = 6e-08 Identities = 26/58 (44%), Positives = 37/58 (63%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS E WG ++KA E +CRY SG+F +E NY ++EKE LA+ R++ K IY+ Sbjct: 533 ASEEFWGGILKAIH--NSHEYICRYASGSFKAAERNYHSNEKELLAVFRVIYKFSIYL 588 Score = 31.2 bits (69), Expect(2) = 6e-08 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K+K K PKLYHP ++ ++IET+ Sbjct: 507 KIKKNLKSFPKLYHPEPNDKLVIETD 532 >BAS06276.1 polymerase polyprotein [Dahlia common mosaic virus] Length = 672 Score = 57.8 bits (138), Expect = 8e-08 Identities = 27/58 (46%), Positives = 42/58 (72%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS+ WG V+KA++ + EL+CRY SGTF +E+NY ++EKE LA+ +++ K IY+ Sbjct: 546 ASDHFWGGVLKAQTT-EGNELICRYSSGTFKPAELNYHSNEKELLAVKQVITKFSIYL 602 >AEL30041.1 polymerase polyprotein [Dahlia common mosaic virus] Length = 673 Score = 57.8 bits (138), Expect = 8e-08 Identities = 27/58 (46%), Positives = 42/58 (72%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS+ WG V+KA++ + EL+CRY SGTF +E+NY ++EKE LA+ +++ K IY+ Sbjct: 547 ASDHFWGGVLKAQTT-EGNELICRYSSGTFKPAELNYHSNEKELLAVKQVITKFSIYL 603 >ABW81763.1 reverse transcriptase [Dahlia mosaic virus-Holland] Length = 673 Score = 57.8 bits (138), Expect = 8e-08 Identities = 27/58 (46%), Positives = 42/58 (72%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS+ WG V+KA++ + EL+CRY SGTF +E+NY ++EKE LA+ +++ K IY+ Sbjct: 547 ASDHFWGGVLKAQTT-EGNELICRYSSGTFKPAELNYHSNEKELLAVKQVITKFSIYL 603 >YP_006907834.1 polyprotein [Horseradish latent virus] AAW56089.1 polyprotein [Horseradish latent virus] Length = 679 Score = 57.8 bits (138), Expect = 8e-08 Identities = 28/62 (45%), Positives = 42/62 (67%), Gaps = 4/62 (6%) Frame = +1 Query: 82 ASNECWGSVMKA----KSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRI 249 AS+ WG ++KA S + EL+CRY SG+F +E NY +++KETLA+IR ++K I Sbjct: 552 ASDNYWGGILKAIHIDLSTNESIELVCRYASGSFKPAEQNYHSNDKETLAVIRTIQKFSI 611 Query: 250 YV 255 Y+ Sbjct: 612 YL 613 >AGQ49469.1 reverse transcriptase [Dahlia mosaic virus] Length = 814 Score = 55.8 bits (133), Expect(2) = 1e-07 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 ASN+ WG V+KAK+ KE +CRY SG+F +E NY ++EKE LA+ + K IY+ Sbjct: 694 ASNDFWGGVLKAKTAD--KEEVCRYTSGSFKTAEKNYHSNEKELLAVKNTISKFSIYL 749 Score = 26.9 bits (58), Expect(2) = 1e-07 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K+K PKLY P ++ +IIET+ Sbjct: 668 KIKKNLTSFPKLYLPKEEEFLIIETD 693 >YP_002519387.1 putative enzymatic polyprotein [Rudbeckia flower distortion virus] ACL36982.1 putative enzymatic polyprotein [Rudbeckia flower distortion virus] Length = 701 Score = 52.0 bits (123), Expect(2) = 1e-07 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = +1 Query: 82 ASNECWGSVMKAKSPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS+E W V+K++ E LCRY SG+F +EINY ++EKE LA+ R + K + Y+ Sbjct: 577 ASHEHWAGVLKSRGT-DNLERLCRYTSGSFKPAEINYHSNEKEVLAVKRTITKFKGYL 633 Score = 30.8 bits (68), Expect(2) = 1e-07 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 5 KLKYLCKDLPKLYHPSDDNLIIIETE 82 K K K+ PKL+HP D +IIET+ Sbjct: 551 KFKRNLKEFPKLHHPLPDEYLIIETD 576 >BAO53526.1 reverse transcriptase [Cauliflower mosaic virus] Length = 671 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/60 (45%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = +1 Query: 82 ASNECWGSVMKAK--SPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS++ WG ++KA + G EL+CRY SG+F +E NY +++KETLA+I ++K IY+ Sbjct: 544 ASDDYWGGMLKAIKINEGTNTELICRYASGSFKTAEKNYHSNDKETLAVINTIKKFSIYL 603 >AHA91342.1 reverse transcriptase [Cauliflower mosaic virus] AHA91352.1 reverse transcriptase [Cauliflower mosaic virus] Length = 674 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/60 (45%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = +1 Query: 82 ASNECWGSVMKAK--SPGQKKELLCRYMSGTFSDSEINYPTHEKETLALIRMLEKHRIYV 255 AS++ WG ++KA + G EL+CRY SG+F +E NY +++KETLA+I ++K IY+ Sbjct: 547 ASDDYWGGMLKAIKINEGANTELICRYASGSFKTAEKNYHSNDKETLAVINTIKKFSIYL 606