BLASTX nr result
ID: Glycyrrhiza28_contig00020572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020572 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016183573.1 PREDICTED: uncharacterized protein LOC107625453 [... 57 1e-06 XP_015949744.1 PREDICTED: uncharacterized protein LOC107474621 [... 57 1e-06 GAU24247.1 hypothetical protein TSUD_23840 [Trifolium subterraneum] 54 9e-06 >XP_016183573.1 PREDICTED: uncharacterized protein LOC107625453 [Arachis ipaensis] Length = 765 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 7/41 (17%) Frame = +1 Query: 328 RNTNTHP-------LPTNRFAETKNLDFSAWFSDNLYKIVA 429 ++TN+ P LPTNRFAETKNLDFSAW S+NLYKIVA Sbjct: 10 KSTNSKPNSRTNGSLPTNRFAETKNLDFSAWVSENLYKIVA 50 >XP_015949744.1 PREDICTED: uncharacterized protein LOC107474621 [Arachis duranensis] Length = 765 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 7/41 (17%) Frame = +1 Query: 328 RNTNTHP-------LPTNRFAETKNLDFSAWFSDNLYKIVA 429 ++TN+ P LPTNRFAETKNLDFSAW S+NLYKIVA Sbjct: 10 KSTNSKPNSRINGSLPTNRFAETKNLDFSAWVSENLYKIVA 50 >GAU24247.1 hypothetical protein TSUD_23840 [Trifolium subterraneum] Length = 789 Score = 54.3 bits (129), Expect = 9e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 322 YLRNTNTHPLPTNRFAETKNLDFSAWFSDNLYKIVA 429 YLR T+ LPTNRF ETKNLDFS W S+NLYKIV+ Sbjct: 26 YLRKTD---LPTNRFTETKNLDFSVWVSENLYKIVS 58