BLASTX nr result
ID: Glycyrrhiza28_contig00020286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020286 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004489387.1 PREDICTED: thyroid adenoma-associated protein hom... 114 2e-27 GAU41066.1 hypothetical protein TSUD_284360 [Trifolium subterran... 105 2e-24 XP_015946098.1 PREDICTED: thyroid adenoma-associated protein hom... 96 9e-21 XP_019442647.1 PREDICTED: thyroid adenoma-associated protein hom... 90 7e-19 XP_019260891.1 PREDICTED: thyroid adenoma-associated protein hom... 88 5e-18 XP_013450958.1 death receptor interacting protein, putative [Med... 88 5e-18 KYP50857.1 Thyroid adenoma-associated protein isogeny [Cajanus c... 87 1e-17 CDX86407.1 BnaA06g31240D [Brassica napus] 86 2e-17 XP_013644522.1 PREDICTED: thyroid adenoma-associated protein hom... 86 2e-17 XP_009151835.1 PREDICTED: thyroid adenoma-associated protein hom... 86 2e-17 XP_013597894.1 PREDICTED: thyroid adenoma-associated protein hom... 86 2e-17 JAU29757.1 Thyroid adenoma-associated protein -like protein, par... 86 3e-17 JAV00518.1 Thyroid adenoma-associated protein -like protein [Noc... 86 3e-17 JAU75595.1 Thyroid adenoma-associated protein -like protein [Noc... 86 3e-17 XP_006349572.1 PREDICTED: thyroid adenoma-associated protein hom... 85 5e-17 JAU07715.1 Thyroid adenoma-associated protein -like protein, par... 84 7e-17 XP_015070091.1 PREDICTED: thyroid adenoma-associated protein hom... 84 7e-17 XP_010317892.1 PREDICTED: thyroid adenoma-associated protein hom... 84 7e-17 XP_009758417.1 PREDICTED: uncharacterized protein LOC104211113 [... 84 1e-16 XP_016476738.1 PREDICTED: thyroid adenoma-associated protein hom... 84 1e-16 >XP_004489387.1 PREDICTED: thyroid adenoma-associated protein homolog [Cicer arietinum] Length = 2209 Score = 114 bits (285), Expect = 2e-27 Identities = 53/79 (67%), Positives = 68/79 (86%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QL+H+K LASSF NLL+S+P P+SEP I AS+LYLE+LFLENS+PLHRTLLS+L KV Sbjct: 54 YSQLSHSKTLASSFLNLLNSEPSPNSEPEITIASKLYLEILFLENSSPLHRTLLSILIKV 113 Query: 257 RTFHSTISGSFRKLLEDYA 313 + FH +SG F+KL+EDY+ Sbjct: 114 KNFHEILSGCFQKLMEDYS 132 >GAU41066.1 hypothetical protein TSUD_284360 [Trifolium subterraneum] Length = 2191 Score = 105 bits (263), Expect = 2e-24 Identities = 50/79 (63%), Positives = 67/79 (84%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QLT AK+LA+SF NL++++ +PDS P I AS+LY ELLFLENS+PLHRTLLSVL KV Sbjct: 53 YSQLTLAKNLAASFINLINNESKPDSAPEIGIASKLYFELLFLENSSPLHRTLLSVLPKV 112 Query: 257 RTFHSTISGSFRKLLEDYA 313 + FH +SGSFR+++E+Y+ Sbjct: 113 KNFHEILSGSFREVVEEYS 131 >XP_015946098.1 PREDICTED: thyroid adenoma-associated protein homolog isoform X1 [Arachis duranensis] Length = 2216 Score = 95.5 bits (236), Expect = 9e-21 Identities = 51/81 (62%), Positives = 62/81 (76%), Gaps = 3/81 (3%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSE---PNIRFASELYLELLFLENSAPLHRTLLSVL 247 ++QL+H+KHLASSFS LL S P+ D P + AS LYLELLFLENSAPLHRTL+SVL Sbjct: 56 FSQLSHSKHLASSFSQLLQSLPQDDHHHHYPALLEASTLYLELLFLENSAPLHRTLVSVL 115 Query: 248 AKVRTFHSTISGSFRKLLEDY 310 AK +T+ I+G F+KL EDY Sbjct: 116 AKEKTWCPFIAGCFKKLCEDY 136 >XP_019442647.1 PREDICTED: thyroid adenoma-associated protein homolog [Lupinus angustifolius] OIW12445.1 hypothetical protein TanjilG_04194 [Lupinus angustifolius] Length = 2218 Score = 90.1 bits (222), Expect = 7e-19 Identities = 48/78 (61%), Positives = 57/78 (73%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QL HAK LASSFS LL+ EP SEP IR AS +YLELLFLENS PLHRTL+S L K Sbjct: 52 YSQLRHAKTLASSFSQLLT---EPRSEPEIREASRIYLELLFLENSTPLHRTLISPLTKT 108 Query: 257 RTFHSTISGSFRKLLEDY 310 +++ I +FR L E+Y Sbjct: 109 QSWKDVIGETFRSLCEEY 126 >XP_019260891.1 PREDICTED: thyroid adenoma-associated protein homolog [Nicotiana attenuata] OIT38850.1 hypothetical protein A4A49_20992 [Nicotiana attenuata] Length = 2186 Score = 87.8 bits (216), Expect = 5e-18 Identities = 47/78 (60%), Positives = 58/78 (74%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QLTHAK+LAS+F+ LLS+ P D +I AS YLE+LFLENS PLHRTLLSVL K Sbjct: 51 YSQLTHAKNLASAFAELLSN-PNADVS-SISTASRFYLEILFLENSQPLHRTLLSVLVKC 108 Query: 257 RTFHSTISGSFRKLLEDY 310 + FH+ I FR+L E+Y Sbjct: 109 KNFHNLIQNCFRELCEEY 126 >XP_013450958.1 death receptor interacting protein, putative [Medicago truncatula] KEH24998.1 death receptor interacting protein, putative [Medicago truncatula] Length = 2197 Score = 87.8 bits (216), Expect = 5e-18 Identities = 43/79 (54%), Positives = 60/79 (75%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QL +K+LASSF NL++ +P I FAS++Y E+LFLENS+PLHRTLL +L KV Sbjct: 53 YSQLPQSKNLASSFINLINDSKI--EKPEIVFASKVYFEILFLENSSPLHRTLLGILPKV 110 Query: 257 RTFHSTISGSFRKLLEDYA 313 + FH +SG FR++LE+Y+ Sbjct: 111 KFFHDLLSGCFREVLEEYS 129 >KYP50857.1 Thyroid adenoma-associated protein isogeny [Cajanus cajan] Length = 1709 Score = 86.7 bits (213), Expect = 1e-17 Identities = 46/74 (62%), Positives = 56/74 (75%) Frame = +2 Query: 80 AQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKVR 259 +QL+HAK LA++F LL S EP+SEP + SELYL LLFLENS PLH+TLLS LAK Sbjct: 57 SQLSHAKPLAATFLRLLQS--EPNSEPPLLLPSELYLHLLFLENSHPLHKTLLSPLAKTT 114 Query: 260 TFHSTISGSFRKLL 301 FHST++ +FR LL Sbjct: 115 PFHSTLAAAFRSLL 128 >CDX86407.1 BnaA06g31240D [Brassica napus] Length = 2053 Score = 86.3 bits (212), Expect = 2e-17 Identities = 42/78 (53%), Positives = 54/78 (69%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 YAQ+ HAK + +SF +LS E + +R A LYLE+LF+ENS PLHRTL+S LAK Sbjct: 55 YAQVNHAKRVVASFGEVLSKTHENEEAAFVREAIRLYLEVLFMENSQPLHRTLVSALAKT 114 Query: 257 RTFHSTISGSFRKLLEDY 310 R FHS IS FR+L ++Y Sbjct: 115 RKFHSVISSCFRELCDEY 132 >XP_013644522.1 PREDICTED: thyroid adenoma-associated protein homolog [Brassica napus] Length = 2092 Score = 86.3 bits (212), Expect = 2e-17 Identities = 42/78 (53%), Positives = 54/78 (69%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 YAQ+ HAK + +SF +LS E + +R A LYLE+LF+ENS PLHRTL+S LAK Sbjct: 55 YAQVNHAKRVVASFGEVLSKAHENEEPAFVREAIRLYLEVLFMENSQPLHRTLVSALAKT 114 Query: 257 RTFHSTISGSFRKLLEDY 310 R FHS IS FR+L ++Y Sbjct: 115 RKFHSVISSCFRELCDEY 132 >XP_009151835.1 PREDICTED: thyroid adenoma-associated protein homolog [Brassica rapa] Length = 2092 Score = 86.3 bits (212), Expect = 2e-17 Identities = 42/78 (53%), Positives = 54/78 (69%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 YAQ+ HAK + +SF +LS E + +R A LYLE+LF+ENS PLHRTL+S LAK Sbjct: 55 YAQVNHAKRVVASFGEVLSKTHENEEAAFVREAIRLYLEVLFMENSQPLHRTLVSALAKT 114 Query: 257 RTFHSTISGSFRKLLEDY 310 R FHS IS FR+L ++Y Sbjct: 115 RKFHSVISSCFRELCDEY 132 >XP_013597894.1 PREDICTED: thyroid adenoma-associated protein homolog [Brassica oleracea var. oleracea] Length = 2100 Score = 85.9 bits (211), Expect = 2e-17 Identities = 44/81 (54%), Positives = 55/81 (67%), Gaps = 3/81 (3%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPN---IRFASELYLELLFLENSAPLHRTLLSVL 247 YAQ+ HAK + +SF +LS E D E +R A LYLE+LF+ENS PLHRTL+S L Sbjct: 55 YAQVNHAKRVVASFGEVLSKTHENDGEKEPAFVREAIRLYLEVLFMENSQPLHRTLVSAL 114 Query: 248 AKVRTFHSTISGSFRKLLEDY 310 AK R FHS IS FR+L ++Y Sbjct: 115 AKTRKFHSVISSCFRELCDEY 135 >JAU29757.1 Thyroid adenoma-associated protein -like protein, partial [Noccaea caerulescens] Length = 1698 Score = 85.5 bits (210), Expect = 3e-17 Identities = 43/82 (52%), Positives = 58/82 (70%), Gaps = 4/82 (4%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEP----NIRFASELYLELLFLENSAPLHRTLLSV 244 YAQ+ HAK + +SF ++LS E +SE ++R A YLE+LF+ENS PLHRTL+S Sbjct: 55 YAQVNHAKKVVASFGDVLSKTHENESEREEAVSVREAIRFYLEILFMENSLPLHRTLVSA 114 Query: 245 LAKVRTFHSTISGSFRKLLEDY 310 LAK+R FHS IS FR+L ++Y Sbjct: 115 LAKIRKFHSVISSCFRELCDEY 136 >JAV00518.1 Thyroid adenoma-associated protein -like protein [Noccaea caerulescens] Length = 2112 Score = 85.5 bits (210), Expect = 3e-17 Identities = 43/82 (52%), Positives = 58/82 (70%), Gaps = 4/82 (4%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEP----NIRFASELYLELLFLENSAPLHRTLLSV 244 YAQ+ HAK + +SF ++LS E +SE ++R A YLE+LF+ENS PLHRTL+S Sbjct: 55 YAQVNHAKKVVASFGDVLSKTHENESEREEAVSVREAIRFYLEILFMENSLPLHRTLVSA 114 Query: 245 LAKVRTFHSTISGSFRKLLEDY 310 LAK+R FHS IS FR+L ++Y Sbjct: 115 LAKIRKFHSVISSCFRELCDEY 136 >JAU75595.1 Thyroid adenoma-associated protein -like protein [Noccaea caerulescens] Length = 2112 Score = 85.5 bits (210), Expect = 3e-17 Identities = 43/82 (52%), Positives = 58/82 (70%), Gaps = 4/82 (4%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEP----NIRFASELYLELLFLENSAPLHRTLLSV 244 YAQ+ HAK + +SF ++LS E +SE ++R A YLE+LF+ENS PLHRTL+S Sbjct: 55 YAQVNHAKKVVASFGDVLSKTHENESEREEAVSVREAIRFYLEILFMENSLPLHRTLVSA 114 Query: 245 LAKVRTFHSTISGSFRKLLEDY 310 LAK+R FHS IS FR+L ++Y Sbjct: 115 LAKIRKFHSVISSCFRELCDEY 136 >XP_006349572.1 PREDICTED: thyroid adenoma-associated protein homolog [Solanum tuberosum] Length = 2187 Score = 84.7 bits (208), Expect = 5e-17 Identities = 46/78 (58%), Positives = 53/78 (67%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QL HAK LASSFS LLS+ E +I AS YLE+L LENS PLHRTLLSVL K Sbjct: 51 YSQLNHAKKLASSFSELLSNVKA--DEESISTASRFYLEILLLENSQPLHRTLLSVLVKC 108 Query: 257 RTFHSTISGSFRKLLEDY 310 FH+ I FR+L E+Y Sbjct: 109 NNFHTLIQNCFRQLCEEY 126 >JAU07715.1 Thyroid adenoma-associated protein -like protein, partial [Noccaea caerulescens] Length = 776 Score = 84.3 bits (207), Expect = 7e-17 Identities = 42/82 (51%), Positives = 58/82 (70%), Gaps = 4/82 (4%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEP----NIRFASELYLELLFLENSAPLHRTLLSV 244 YAQ+ HAK + +SF ++L+ E +SE ++R A YLE+LF+ENS PLHRTL+S Sbjct: 55 YAQVNHAKKVVASFGDVLAKTHENESEREEAVSVREAIRFYLEILFMENSLPLHRTLVSA 114 Query: 245 LAKVRTFHSTISGSFRKLLEDY 310 LAK+R FHS IS FR+L ++Y Sbjct: 115 LAKIRKFHSVISSCFRELCDEY 136 >XP_015070091.1 PREDICTED: thyroid adenoma-associated protein homolog [Solanum pennellii] Length = 2173 Score = 84.3 bits (207), Expect = 7e-17 Identities = 45/78 (57%), Positives = 53/78 (67%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QL HAK LASSFS LLS+ D +I AS YLE+L LENS PLHRTLLSVL K Sbjct: 51 YSQLNHAKKLASSFSELLSNVKADDE--SISTASRFYLEILLLENSQPLHRTLLSVLVKC 108 Query: 257 RTFHSTISGSFRKLLEDY 310 FH+ I FR++ E+Y Sbjct: 109 NNFHTLIQNCFRQICEEY 126 >XP_010317892.1 PREDICTED: thyroid adenoma-associated protein homolog [Solanum lycopersicum] Length = 2174 Score = 84.3 bits (207), Expect = 7e-17 Identities = 45/78 (57%), Positives = 53/78 (67%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QL HAK LASSFS LLS+ D +I AS YLE+L LENS PLHRTLLSVL K Sbjct: 51 YSQLNHAKKLASSFSELLSNVKADDE--SISTASRFYLEILLLENSQPLHRTLLSVLVKC 108 Query: 257 RTFHSTISGSFRKLLEDY 310 FH+ I FR++ E+Y Sbjct: 109 NNFHTLIQNCFRQICEEY 126 >XP_009758417.1 PREDICTED: uncharacterized protein LOC104211113 [Nicotiana sylvestris] Length = 1097 Score = 84.0 bits (206), Expect = 1e-16 Identities = 45/78 (57%), Positives = 57/78 (73%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QLTHAK+LAS+F+ LL + P D +I AS YLE+LFLENS PLHRTLL+VL K Sbjct: 51 YSQLTHAKNLASAFAELLLN-PNADVS-SISTASRFYLEILFLENSQPLHRTLLTVLVKC 108 Query: 257 RTFHSTISGSFRKLLEDY 310 + FH+ I FR+L E+Y Sbjct: 109 KNFHNLIRNCFRELCEEY 126 >XP_016476738.1 PREDICTED: thyroid adenoma-associated protein homolog [Nicotiana tabacum] Length = 2186 Score = 84.0 bits (206), Expect = 1e-16 Identities = 45/78 (57%), Positives = 57/78 (73%) Frame = +2 Query: 77 YAQLTHAKHLASSFSNLLSSQPEPDSEPNIRFASELYLELLFLENSAPLHRTLLSVLAKV 256 Y+QLTHAK+LAS+F+ LL + P D +I AS YLE+LFLENS PLHRTLL+VL K Sbjct: 51 YSQLTHAKNLASAFAELLLN-PNADVS-SISTASRFYLEILFLENSQPLHRTLLTVLVKC 108 Query: 257 RTFHSTISGSFRKLLEDY 310 + FH+ I FR+L E+Y Sbjct: 109 KNFHNLIRNCFRELCEEY 126