BLASTX nr result
ID: Glycyrrhiza28_contig00020231
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020231 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SFK54118.1 hypothetical protein SAMN04488125_102341 [Methylobact... 75 9e-16 WP_056247153.1 hypothetical protein [Methylobacterium sp. Leaf45... 69 4e-13 WP_012453936.1 hypothetical protein [Methylobacterium populi] AC... 59 2e-09 WP_017485425.1 hypothetical protein [Methylobacterium sp. MB200] 59 4e-09 BAU90787.1 hypothetical protein MPPM_2182 [Methylobacterium populi] 57 1e-08 WP_060769638.1 hypothetical protein [Methylobacterium sp. AMS5] ... 56 3e-08 WP_056194804.1 hypothetical protein [Methylobacterium sp. Leaf12... 56 3e-08 WP_003598027.1 MULTISPECIES: hypothetical protein [Methylobacter... 56 5e-08 >SFK54118.1 hypothetical protein SAMN04488125_102341 [Methylobacterium salsuginis] Length = 98 Score = 75.5 bits (184), Expect = 9e-16 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 183 MSRTGHRSAARNYLPESKLEDLAVRLRRLANHRGLVREEI 302 MSR GHR+AARNYLPESKLEDLA+RLRRLANHRGLVR EI Sbjct: 1 MSRPGHRTAARNYLPESKLEDLAIRLRRLANHRGLVRREI 40 >WP_056247153.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT47683.1 hypothetical protein ASG52_10425 [Methylobacterium sp. Leaf456] Length = 102 Score = 68.9 bits (167), Expect = 4e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 183 MSRTGHRSAARNYLPESKLEDLAVRLRRLANHRGLVREEI 302 M R HR+AARNYLPES+LEDLA+RLRRLANHRG VREEI Sbjct: 1 MPRPTHRTAARNYLPESRLEDLALRLRRLANHRGFVREEI 40 >WP_012453936.1 hypothetical protein [Methylobacterium populi] ACB80192.1 conserved hypothetical protein [Methylobacterium populi BJ001] OAH17183.1 hypothetical protein AX289_08770 [Methylobacterium populi] Length = 99 Score = 59.3 bits (142), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +3 Query: 183 MSRTGH-RSAARNYLPESKLEDLAVRLRRLANHRGLVREEI 302 MS++G R++AR YLPESKLEDLA LRRLANHRGLVR EI Sbjct: 1 MSQSGRARASARQYLPESKLEDLASSLRRLANHRGLVRSEI 41 >WP_017485425.1 hypothetical protein [Methylobacterium sp. MB200] Length = 99 Score = 58.5 bits (140), Expect = 4e-09 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +3 Query: 183 MSRTGH-RSAARNYLPESKLEDLAVRLRRLANHRGLVREEI 302 MS G R++AR YLPESKLEDLA LRRLANHRGLVR EI Sbjct: 1 MSHAGRARASARQYLPESKLEDLASSLRRLANHRGLVRSEI 41 >BAU90787.1 hypothetical protein MPPM_2182 [Methylobacterium populi] Length = 99 Score = 57.4 bits (137), Expect = 1e-08 Identities = 31/41 (75%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 183 MSRTGH-RSAARNYLPESKLEDLAVRLRRLANHRGLVREEI 302 MS G R +AR YLPESKLEDLA LRRLANHRGLVR EI Sbjct: 1 MSHAGRARVSARQYLPESKLEDLASSLRRLANHRGLVRSEI 41 >WP_060769638.1 hypothetical protein [Methylobacterium sp. AMS5] AMB45210.1 hypothetical protein Y590_09870 [Methylobacterium sp. AMS5] Length = 99 Score = 56.2 bits (134), Expect = 3e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 201 RSAARNYLPESKLEDLAVRLRRLANHRGLVREEI 302 R++AR YLPESKL+DLA LRRLANHRGLVR EI Sbjct: 8 RTSARQYLPESKLDDLASSLRRLANHRGLVRSEI 41 >WP_056194804.1 hypothetical protein [Methylobacterium sp. Leaf123] KQQ30732.1 hypothetical protein ASF53_18330 [Methylobacterium sp. Leaf123] Length = 99 Score = 56.2 bits (134), Expect = 3e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 201 RSAARNYLPESKLEDLAVRLRRLANHRGLVREEI 302 R++AR YLPESKL+DLA LRRLANHRGLVR EI Sbjct: 8 RTSARQYLPESKLDDLASSLRRLANHRGLVRSEI 41 >WP_003598027.1 MULTISPECIES: hypothetical protein [Methylobacterium] ABY30465.1 hypothetical protein Mext_2069 [Methylobacterium extorquens PA1] ACK83188.1 conserved hypothetical protein [Methylobacterium extorquens CM4] ACS39853.1 hypothetical protein MexAM1_META1p2051 [Methylobacterium extorquens AM1] CAX24491.1 hypothetical protein METDI2835 [Methylobacterium extorquens DM4] EHP93848.1 hypothetical protein MetexDRAFT_1265 [Methylobacterium extorquens DSM 13060] KQO78473.1 hypothetical protein ASF36_11440 [Methylobacterium sp. Leaf90] KQO89043.1 hypothetical protein ASF33_20795 [Methylobacterium sp. Leaf92] KQP89126.1 hypothetical protein ASF55_03320 [Methylobacterium sp. Leaf119] KQQ00391.1 hypothetical protein ASF59_04050 [Methylobacterium sp. Leaf121] KQQ04388.1 hypothetical protein ASF56_11565 [Methylobacterium sp. Leaf122] OHV16285.1 hypothetical protein BK022_13200 [Methylobacterium extorquens] APX87373.1 hypothetical protein BV511_23290 [Methylobacterium extorquens] Length = 99 Score = 55.8 bits (133), Expect = 5e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 201 RSAARNYLPESKLEDLAVRLRRLANHRGLVREEI 302 R++AR YLPESKL+DLA LRRLANHRGL+R EI Sbjct: 8 RTSARQYLPESKLDDLASSLRRLANHRGLIRSEI 41