BLASTX nr result
ID: Glycyrrhiza28_contig00020228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020228 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019417966.1 PREDICTED: uncharacterized protein LOC109328822 [... 57 4e-07 >XP_019417966.1 PREDICTED: uncharacterized protein LOC109328822 [Lupinus angustifolius] OIV95218.1 hypothetical protein TanjilG_21608 [Lupinus angustifolius] Length = 384 Score = 57.4 bits (137), Expect = 4e-07 Identities = 34/71 (47%), Positives = 39/71 (54%) Frame = +1 Query: 163 MFKALLCRNGFGITRKSPTPKLDPLFYHWPFPFPLRFLCXXXXXXXXXXXXXXXFVVSYL 342 MFKALL N + SPTPK +P +H+ F FPL+F F VSYL Sbjct: 6 MFKALLSLNLNSLP--SPTPKCNPFLHHYSFTFPLKFYTTTSDPKS--------FTVSYL 55 Query: 343 INNLGFSPESA 375 INN GFSPESA Sbjct: 56 INNFGFSPESA 66