BLASTX nr result
ID: Glycyrrhiza28_contig00020179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020179 (528 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU38761.1 hypothetical protein TSUD_64920 [Trifolium subterraneum] 42 7e-06 >GAU38761.1 hypothetical protein TSUD_64920 [Trifolium subterraneum] Length = 533 Score = 42.4 bits (98), Expect(2) = 7e-06 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +3 Query: 399 LMDFIN*QTSVTYVYRVANRCADILARHGHLGTFSWIILDI*C 527 L+ N +TS+ +VYR ANRCAD L GH +F I+++ C Sbjct: 470 LLQHPNWETSIAHVYREANRCADFLTNKGHSSSFEGDIVNLAC 512 Score = 34.7 bits (78), Expect(2) = 7e-06 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +2 Query: 293 PRVMFELDSQVI-NCVRAGHFGIAPLQPILDEIL 391 P+V+FE+DS+VI N V +GH A L P+L E++ Sbjct: 435 PKVVFEMDSKVIVNMVTSGHTNNAYLSPLLGEVV 468