BLASTX nr result
ID: Glycyrrhiza28_contig00020010
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00020010 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN68936.1 hypothetical protein VITISV_042323 [Vitis vinifera] 53 2e-06 XP_019447774.1 PREDICTED: mediator of RNA polymerase II transcri... 55 2e-06 XP_017424935.1 PREDICTED: mediator of RNA polymerase II transcri... 55 2e-06 XP_019447772.1 PREDICTED: mediator of RNA polymerase II transcri... 55 2e-06 XP_017424933.1 PREDICTED: mediator of RNA polymerase II transcri... 55 2e-06 XP_014501193.1 PREDICTED: mediator of RNA polymerase II transcri... 55 2e-06 XP_007150838.1 hypothetical protein PHAVU_005G185100g [Phaseolus... 55 2e-06 XP_014620495.1 PREDICTED: mediator of RNA polymerase II transcri... 54 6e-06 XP_003539481.1 PREDICTED: mediator of RNA polymerase II transcri... 54 6e-06 XP_004490078.1 PREDICTED: mediator of RNA polymerase II transcri... 54 6e-06 KHN31855.1 hypothetical protein glysoja_036173 [Glycine soja] 54 6e-06 XP_004490076.1 PREDICTED: mediator of RNA polymerase II transcri... 54 6e-06 >CAN68936.1 hypothetical protein VITISV_042323 [Vitis vinifera] Length = 155 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/45 (60%), Positives = 30/45 (66%) Frame = -2 Query: 153 LITVDFAVSVERNWDDSVVCSEVSPYQTVDSECLMPCHQMHLVIH 19 L T DFAVSV NWDDS S P Q VDSE L+ C++MHLV H Sbjct: 92 LFTADFAVSVAGNWDDSESRSGGLPCQVVDSEHLVACYRMHLVSH 136 >XP_019447774.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8 isoform X2 [Lupinus angustifolius] OIW09235.1 hypothetical protein TanjilG_26448 [Lupinus angustifolius] Length = 515 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSGMVTLQNTQQNHPNFS Sbjct: 482 MASNAQNLQSGMVTLQNTQQNHPNFS 507 >XP_017424935.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8 isoform X2 [Vigna angularis] Length = 519 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSGMVTLQNTQQNHPNFS Sbjct: 486 MASNAQNLQSGMVTLQNTQQNHPNFS 511 >XP_019447772.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8 isoform X1 [Lupinus angustifolius] Length = 521 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSGMVTLQNTQQNHPNFS Sbjct: 488 MASNAQNLQSGMVTLQNTQQNHPNFS 513 >XP_017424933.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8 isoform X1 [Vigna angularis] BAT91420.1 hypothetical protein VIGAN_07001500 [Vigna angularis var. angularis] Length = 537 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSGMVTLQNTQQNHPNFS Sbjct: 504 MASNAQNLQSGMVTLQNTQQNHPNFS 529 >XP_014501193.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8 [Vigna radiata var. radiata] Length = 538 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSGMVTLQNTQQNHPNFS Sbjct: 505 MASNAQNLQSGMVTLQNTQQNHPNFS 530 >XP_007150838.1 hypothetical protein PHAVU_005G185100g [Phaseolus vulgaris] ESW22832.1 hypothetical protein PHAVU_005G185100g [Phaseolus vulgaris] Length = 538 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSGMVTLQNTQQNHPNFS Sbjct: 505 MASNAQNLQSGMVTLQNTQQNHPNFS 530 >XP_014620495.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X2 [Glycine max] Length = 496 Score = 53.5 bits (127), Expect = 6e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSG+VTLQNTQQNHPNFS Sbjct: 463 MASNAQNLQSGLVTLQNTQQNHPNFS 488 >XP_003539481.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Glycine max] XP_006592775.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Glycine max] XP_006592776.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Glycine max] XP_006592777.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Glycine max] KHN17975.1 hypothetical protein glysoja_035061 [Glycine soja] KRH26680.1 hypothetical protein GLYMA_12G188300 [Glycine max] KRH26681.1 hypothetical protein GLYMA_12G188300 [Glycine max] KRH26682.1 hypothetical protein GLYMA_12G188300 [Glycine max] KRH26683.1 hypothetical protein GLYMA_12G188300 [Glycine max] Length = 515 Score = 53.5 bits (127), Expect = 6e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSG+VTLQNTQQNHPNFS Sbjct: 482 MASNAQNLQSGLVTLQNTQQNHPNFS 507 >XP_004490078.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X2 [Cicer arietinum] XP_004490079.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X2 [Cicer arietinum] XP_004490080.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X2 [Cicer arietinum] XP_004490081.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X2 [Cicer arietinum] XP_004490082.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X2 [Cicer arietinum] Length = 529 Score = 53.5 bits (127), Expect = 6e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSGM+TLQNTQQNHPNFS Sbjct: 496 MASNAQNLQSGMMTLQNTQQNHPNFS 521 >KHN31855.1 hypothetical protein glysoja_036173 [Glycine soja] Length = 531 Score = 53.5 bits (127), Expect = 6e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSG+VTLQNTQQNHPNFS Sbjct: 498 MASNAQNLQSGLVTLQNTQQNHPNFS 523 >XP_004490076.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Cicer arietinum] XP_012568290.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Cicer arietinum] XP_012568291.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Cicer arietinum] XP_012568292.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Cicer arietinum] XP_012568293.1 PREDICTED: mediator of RNA polymerase II transcription subunit 8-like isoform X1 [Cicer arietinum] Length = 572 Score = 53.5 bits (127), Expect = 6e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 45 MASNTQNLQSGMVTLQNTQQNHPNFS 122 MASN QNLQSGM+TLQNTQQNHPNFS Sbjct: 539 MASNAQNLQSGMMTLQNTQQNHPNFS 564