BLASTX nr result
ID: Glycyrrhiza28_contig00019956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00019956 (329 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP73379.1 DNA/RNA-binding protein KIN17 [Cajanus cajan] 64 8e-10 XP_007142247.1 hypothetical protein PHAVU_008G264800g [Phaseolus... 63 3e-09 XP_019435380.1 PREDICTED: DNA/RNA-binding protein KIN17 [Lupinus... 63 3e-09 ONI12055.1 hypothetical protein PRUPE_4G141400 [Prunus persica] ... 60 4e-09 XP_014503521.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Vi... 62 4e-09 KOM45258.1 hypothetical protein LR48_Vigan06g056400 [Vigna angul... 62 4e-09 XP_011085443.1 PREDICTED: DNA/RNA-binding protein KIN17 [Sesamum... 62 4e-09 XP_007155366.1 hypothetical protein PHAVU_003G195200g [Phaseolus... 62 4e-09 XP_010111141.1 hypothetical protein L484_010755 [Morus notabilis... 62 5e-09 XP_004491366.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Ci... 62 5e-09 OAY46090.1 hypothetical protein MANES_07G115700 [Manihot esculenta] 62 5e-09 XP_015973313.1 PREDICTED: DNA/RNA-binding protein KIN17 [Arachis... 62 5e-09 CDP04618.1 unnamed protein product [Coffea canephora] 62 7e-09 XP_016722329.1 PREDICTED: DNA/RNA-binding protein KIN17 [Gossypi... 62 7e-09 XP_012455987.1 PREDICTED: DNA/RNA-binding protein KIN17 [Gossypi... 62 7e-09 XP_017620458.1 PREDICTED: DNA/RNA-binding protein KIN17 [Gossypi... 62 7e-09 XP_012568664.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Ci... 61 8e-09 GAU30717.1 hypothetical protein TSUD_39410 [Trifolium subterraneum] 60 8e-09 CDY08243.1 BnaA05g13760D [Brassica napus] 59 9e-09 XP_002891834.1 predicted protein [Arabidopsis lyrata subsp. lyra... 59 9e-09 >KYP73379.1 DNA/RNA-binding protein KIN17 [Cajanus cajan] Length = 398 Score = 64.3 bits (155), Expect = 8e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVA 238 KFCAKVQIEKGPYDGR+LKA+EYEDICKVA Sbjct: 369 KFCAKVQIEKGPYDGRVLKAMEYEDICKVA 398 >XP_007142247.1 hypothetical protein PHAVU_008G264800g [Phaseolus vulgaris] ESW14241.1 hypothetical protein PHAVU_008G264800g [Phaseolus vulgaris] Length = 396 Score = 62.8 bits (151), Expect = 3e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVA 238 FCAKVQIEKGPYDGRILKA+EYEDICKVA Sbjct: 368 FCAKVQIEKGPYDGRILKAMEYEDICKVA 396 >XP_019435380.1 PREDICTED: DNA/RNA-binding protein KIN17 [Lupinus angustifolius] OIW16330.1 hypothetical protein TanjilG_19046 [Lupinus angustifolius] Length = 398 Score = 62.8 bits (151), Expect = 3e-09 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVA 238 FCAKVQ+EKGPYDGR+LKAVEYEDICK+A Sbjct: 370 FCAKVQVEKGPYDGRVLKAVEYEDICKIA 398 >ONI12055.1 hypothetical protein PRUPE_4G141400 [Prunus persica] ONI12056.1 hypothetical protein PRUPE_4G141400 [Prunus persica] ONI12057.1 hypothetical protein PRUPE_4G141400 [Prunus persica] Length = 165 Score = 60.5 bits (145), Expect = 4e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVA 238 KFCAKVQIEKG YDGR+LKAVEYEDICK+A Sbjct: 136 KFCAKVQIEKGVYDGRLLKAVEYEDICKLA 165 >XP_014503521.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Vigna radiata var. radiata] Length = 398 Score = 62.4 bits (150), Expect = 4e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVA 238 FCAKVQIEKGPYDGR+LKA+EYEDICKVA Sbjct: 370 FCAKVQIEKGPYDGRVLKAMEYEDICKVA 398 >KOM45258.1 hypothetical protein LR48_Vigan06g056400 [Vigna angularis] BAT99917.1 hypothetical protein VIGAN_10146000 [Vigna angularis var. angularis] Length = 398 Score = 62.4 bits (150), Expect = 4e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVA 238 FCAKVQIEKGPYDGR+LKA+EYEDICKVA Sbjct: 370 FCAKVQIEKGPYDGRVLKAMEYEDICKVA 398 >XP_011085443.1 PREDICTED: DNA/RNA-binding protein KIN17 [Sesamum indicum] Length = 399 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 235 KFCAKVQIEKG YDGR+LKAVEYEDICK+AQ Sbjct: 369 KFCAKVQIEKGIYDGRVLKAVEYEDICKLAQ 399 >XP_007155366.1 hypothetical protein PHAVU_003G195200g [Phaseolus vulgaris] ESW27360.1 hypothetical protein PHAVU_003G195200g [Phaseolus vulgaris] Length = 399 Score = 62.4 bits (150), Expect = 4e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVA 238 FCAKVQIEKGPYDGR+LKA+EYEDICKVA Sbjct: 371 FCAKVQIEKGPYDGRVLKAMEYEDICKVA 399 >XP_010111141.1 hypothetical protein L484_010755 [Morus notabilis] EXC30506.1 hypothetical protein L484_010755 [Morus notabilis] Length = 368 Score = 62.0 bits (149), Expect = 5e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 235 KFCAKVQIEKG YDGR+LKAVEYEDICK+ Q Sbjct: 338 KFCAKVQIEKGVYDGRVLKAVEYEDICKIVQ 368 >XP_004491366.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Cicer arietinum] Length = 397 Score = 62.0 bits (149), Expect = 5e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVA 238 FCAKVQIEKGPYDGR+LKAVEYEDICK A Sbjct: 369 FCAKVQIEKGPYDGRVLKAVEYEDICKAA 397 >OAY46090.1 hypothetical protein MANES_07G115700 [Manihot esculenta] Length = 400 Score = 62.0 bits (149), Expect = 5e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 235 KFCAKVQ+EKG YDGR+LKAVEYEDICK+AQ Sbjct: 370 KFCAKVQVEKGIYDGRVLKAVEYEDICKLAQ 400 >XP_015973313.1 PREDICTED: DNA/RNA-binding protein KIN17 [Arachis duranensis] Length = 401 Score = 62.0 bits (149), Expect = 5e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVAQ 235 FCAKVQIEKG YDGR+LKAVEYEDICK+AQ Sbjct: 372 FCAKVQIEKGAYDGRVLKAVEYEDICKIAQ 401 >CDP04618.1 unnamed protein product [Coffea canephora] Length = 391 Score = 61.6 bits (148), Expect = 7e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVAQ 235 KFCAKVQIEKG YDGR++KAVEYEDICK+AQ Sbjct: 361 KFCAKVQIEKGIYDGRVIKAVEYEDICKLAQ 391 >XP_016722329.1 PREDICTED: DNA/RNA-binding protein KIN17 [Gossypium hirsutum] Length = 394 Score = 61.6 bits (148), Expect = 7e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVA 238 KFCAKVQIEKG YDGR+LKA+EYEDICKVA Sbjct: 365 KFCAKVQIEKGVYDGRVLKAIEYEDICKVA 394 >XP_012455987.1 PREDICTED: DNA/RNA-binding protein KIN17 [Gossypium raimondii] KJB73906.1 hypothetical protein B456_011G260400 [Gossypium raimondii] Length = 394 Score = 61.6 bits (148), Expect = 7e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVA 238 KFCAKVQIEKG YDGR+LKA+EYEDICKVA Sbjct: 365 KFCAKVQIEKGVYDGRVLKAIEYEDICKVA 394 >XP_017620458.1 PREDICTED: DNA/RNA-binding protein KIN17 [Gossypium arboreum] KHG03219.1 DNA/RNA-binding KIN17 [Gossypium arboreum] Length = 394 Score = 61.6 bits (148), Expect = 7e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVA 238 KFCAKVQIEKG YDGR+LKA+EYEDICKVA Sbjct: 365 KFCAKVQIEKGVYDGRVLKAIEYEDICKVA 394 >XP_012568664.1 PREDICTED: DNA/RNA-binding protein KIN17-like [Cicer arietinum] Length = 244 Score = 60.8 bits (146), Expect = 8e-09 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVA 238 FCAKVQI+KGPYDGR+LKAVEYEDICK+A Sbjct: 216 FCAKVQIKKGPYDGRVLKAVEYEDICKLA 244 >GAU30717.1 hypothetical protein TSUD_39410 [Trifolium subterraneum] Length = 214 Score = 60.5 bits (145), Expect = 8e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 324 FCAKVQIEKGPYDGRILKAVEYEDICKVA 238 FCAKVQIEKG YDGR+LKAVEYEDICKVA Sbjct: 186 FCAKVQIEKGAYDGRVLKAVEYEDICKVA 214 >CDY08243.1 BnaA05g13760D [Brassica napus] Length = 121 Score = 58.5 bits (140), Expect = 9e-09 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVA 238 KFCAKVQIEKG Y+GR++KA+EYED+CK+A Sbjct: 92 KFCAKVQIEKGVYEGRVIKAIEYEDVCKIA 121 >XP_002891834.1 predicted protein [Arabidopsis lyrata subsp. lyrata] EFH68093.1 predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 121 Score = 58.5 bits (140), Expect = 9e-09 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 327 KFCAKVQIEKGPYDGRILKAVEYEDICKVA 238 KFCAKVQIEKG YDGR++K++EYEDICK+A Sbjct: 92 KFCAKVQIEKGVYDGRVIKSIEYEDICKLA 121