BLASTX nr result
ID: Glycyrrhiza28_contig00019708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00019708 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006445343.1 hypothetical protein CICLE_v10022623mg [Citrus cl... 72 5e-14 XP_006490840.1 PREDICTED: uncharacterized protein LOC102629142 [... 72 6e-14 XP_016186443.1 PREDICTED: uncharacterized protein LOC107628163 [... 69 2e-13 XP_015948330.1 PREDICTED: uncharacterized protein LOC107473291 [... 69 2e-13 XP_007052203.1 PREDICTED: uncharacterized protein LOC18614392 [T... 69 2e-13 XP_017610129.1 PREDICTED: uncharacterized protein LOC108456048 [... 69 2e-13 OMP00663.1 hypothetical protein COLO4_12464 [Corchorus olitorius] 69 2e-13 XP_007140977.1 hypothetical protein PHAVU_008G156800g [Phaseolus... 69 2e-13 OMO69526.1 hypothetical protein CCACVL1_19448 [Corchorus capsula... 69 2e-13 XP_006583549.1 PREDICTED: uncharacterized protein LOC100814035 [... 69 2e-13 XP_007134549.1 hypothetical protein PHAVU_010G056400g [Phaseolus... 69 2e-13 XP_003521088.1 PREDICTED: uncharacterized protein LOC100802738 [... 69 2e-13 XP_010089254.1 hypothetical protein L484_021784 [Morus notabilis... 69 2e-13 AFK34583.1 unknown [Lotus japonicus] 69 2e-13 XP_015971502.1 PREDICTED: uncharacterized protein LOC107494973 [... 67 8e-13 XP_012083644.1 PREDICTED: uncharacterized protein LOC105643180 i... 67 1e-12 XP_017441667.1 PREDICTED: uncharacterized protein LOC108347062 i... 67 1e-12 XP_012475325.1 PREDICTED: uncharacterized protein LOC105791677 [... 67 1e-12 OAY62476.1 hypothetical protein MANES_01G270500 [Manihot esculenta] 67 1e-12 OAY49368.1 hypothetical protein MANES_05G050600 [Manihot esculenta] 67 1e-12 >XP_006445343.1 hypothetical protein CICLE_v10022623mg [Citrus clementina] ESR58583.1 hypothetical protein CICLE_v10022623mg [Citrus clementina] Length = 160 Score = 71.6 bits (174), Expect = 5e-14 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 123 ISNSQFQAMVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 I NS+ MVDLQTVCCMCGDVGFPDKLFRCNKCR+ Sbjct: 27 IKNSRLLTMVDLQTVCCMCGDVGFPDKLFRCNKCRN 62 >XP_006490840.1 PREDICTED: uncharacterized protein LOC102629142 [Citrus sinensis] Length = 164 Score = 71.6 bits (174), Expect = 6e-14 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 123 ISNSQFQAMVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 I NS+ MVDLQTVCCMCGDVGFPDKLFRCNKCR+ Sbjct: 31 IKNSRLLTMVDLQTVCCMCGDVGFPDKLFRCNKCRN 66 >XP_016186443.1 PREDICTED: uncharacterized protein LOC107628163 [Arachis ipaensis] Length = 118 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >XP_015948330.1 PREDICTED: uncharacterized protein LOC107473291 [Arachis duranensis] Length = 118 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >XP_007052203.1 PREDICTED: uncharacterized protein LOC18614392 [Theobroma cacao] EOX96360.1 Late cornified envelope protein 1E [Theobroma cacao] Length = 123 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >XP_017610129.1 PREDICTED: uncharacterized protein LOC108456048 [Gossypium arboreum] KHG04548.1 Potassium voltage-gated channel subfamily C member 4 [Gossypium arboreum] Length = 124 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >OMP00663.1 hypothetical protein COLO4_12464 [Corchorus olitorius] Length = 125 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >XP_007140977.1 hypothetical protein PHAVU_008G156800g [Phaseolus vulgaris] ESW12971.1 hypothetical protein PHAVU_008G156800g [Phaseolus vulgaris] Length = 125 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >OMO69526.1 hypothetical protein CCACVL1_19448 [Corchorus capsularis] Length = 126 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >XP_006583549.1 PREDICTED: uncharacterized protein LOC100814035 [Glycine max] KHN25071.1 hypothetical protein glysoja_027485 [Glycine soja] ALA09246.1 PHD transcription factor, partial [Glycine max] KRH48743.1 hypothetical protein GLYMA_07G109200 [Glycine max] Length = 126 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >XP_007134549.1 hypothetical protein PHAVU_010G056400g [Phaseolus vulgaris] ESW06543.1 hypothetical protein PHAVU_010G056400g [Phaseolus vulgaris] Length = 126 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >XP_003521088.1 PREDICTED: uncharacterized protein LOC100802738 [Glycine max] KHN10890.1 hypothetical protein glysoja_038189 [Glycine soja] KRH66616.1 hypothetical protein GLYMA_03G117800 [Glycine max] Length = 127 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >XP_010089254.1 hypothetical protein L484_021784 [Morus notabilis] EXB37579.1 hypothetical protein L484_021784 [Morus notabilis] Length = 130 Score = 69.3 bits (168), Expect = 2e-13 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 28 >AFK34583.1 unknown [Lotus japonicus] Length = 119 Score = 68.9 bits (167), Expect = 2e-13 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGD+GFPDKLFRCNKCRH Sbjct: 1 MVDLQTVCCMCGDIGFPDKLFRCNKCRH 28 >XP_015971502.1 PREDICTED: uncharacterized protein LOC107494973 [Arachis duranensis] Length = 84 Score = 66.6 bits (161), Expect = 8e-13 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKCR+ Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCRN 28 >XP_012083644.1 PREDICTED: uncharacterized protein LOC105643180 isoform X2 [Jatropha curcas] Length = 122 Score = 67.4 bits (163), Expect = 1e-12 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRC+KCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCSKCRH 28 >XP_017441667.1 PREDICTED: uncharacterized protein LOC108347062 isoform X3 [Vigna angularis] Length = 124 Score = 67.4 bits (163), Expect = 1e-12 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRC+KCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCSKCRH 28 >XP_012475325.1 PREDICTED: uncharacterized protein LOC105791677 [Gossypium raimondii] XP_016682037.1 PREDICTED: uncharacterized protein LOC107900824 [Gossypium hirsutum] KJB24851.1 hypothetical protein B456_004G164800 [Gossypium raimondii] Length = 124 Score = 67.4 bits (163), Expect = 1e-12 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRCNKC H Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCNKCHH 28 >OAY62476.1 hypothetical protein MANES_01G270500 [Manihot esculenta] Length = 125 Score = 67.4 bits (163), Expect = 1e-12 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRC+KCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCSKCRH 28 >OAY49368.1 hypothetical protein MANES_05G050600 [Manihot esculenta] Length = 125 Score = 67.4 bits (163), Expect = 1e-12 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 147 MVDLQTVCCMCGDVGFPDKLFRCNKCRH 230 MVDLQTVCCMCGDVGFPDKLFRC+KCRH Sbjct: 1 MVDLQTVCCMCGDVGFPDKLFRCSKCRH 28