BLASTX nr result
ID: Glycyrrhiza28_contig00019697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00019697 (589 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003625624.1 hypothetical protein MTR_7g101160 [Medicago trunc... 53 7e-06 >XP_003625624.1 hypothetical protein MTR_7g101160 [Medicago truncatula] AES81842.1 hypothetical protein MTR_7g101160 [Medicago truncatula] Length = 98 Score = 52.8 bits (125), Expect = 7e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +1 Query: 457 LCVPGSLYAICRAHQYGDGLSEWRARSHAC 546 L VPGSLYAICR H D LSEWR RSHAC Sbjct: 2 LSVPGSLYAICRVHHDSDELSEWRTRSHAC 31