BLASTX nr result
ID: Glycyrrhiza28_contig00019539
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00019539 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Q9MB42.1 RecName: Full=Beta-amyrin synthase BAA89815.1 beta-amyr... 129 4e-32 AOT81870.1 beta-amyrin synthase [Glycyrrhiza inflata] AOT81871.1... 127 1e-31 ACV21067.1 beta-amyrin synthase [Glycyrrhiza uralensis] 127 1e-31 ADE88148.1 beta-amyrin synthase [Glycyrrhiza uralensis] AOT81869... 127 1e-31 GAU16151.1 hypothetical protein TSUD_297810 [Trifolium subterran... 124 8e-31 NP_001236591.1 beta-amyrin synthase [Glycine max] AAM23264.1 bet... 125 9e-31 AAO33579.1 putative beta-amyrin synthase, partial [Lotus japonicus] 125 9e-31 BAE53429.1 beta-amyrin synthase [Lotus japonicus] 125 9e-31 AHI17180.1 beta-amyrin synthase, partial [Glycine max] 125 9e-31 XP_006582958.1 PREDICTED: beta-amyrin synthase isoform X1 [Glyci... 125 9e-31 XP_003531781.1 PREDICTED: beta-amyrin synthase [Glycine max] KRH... 125 9e-31 KHN39383.1 Beta-amyrin synthase [Glycine soja] 125 9e-31 KHN38108.1 Beta-amyrin synthase [Glycine soja] 125 9e-31 XP_004488915.1 PREDICTED: beta-amyrin synthase [Cicer arietinum] 124 2e-30 XP_003604121.1 beta-amyrin synthase [Medicago truncatula] CAD232... 124 2e-30 AAO33578.1 beta-amyrin synthase [Medicago truncatula] 124 2e-30 XP_019456173.1 PREDICTED: beta-amyrin synthase isoform X2 [Lupin... 121 2e-29 XP_019456165.1 PREDICTED: beta-amyrin synthase isoform X1 [Lupin... 121 2e-29 KYP53858.1 Beta-amyrin synthase [Cajanus cajan] 119 7e-29 XP_007135871.1 hypothetical protein PHAVU_010G165100g [Phaseolus... 119 7e-29 >Q9MB42.1 RecName: Full=Beta-amyrin synthase BAA89815.1 beta-amyrin synthase [Glycyrrhiza glabra] Length = 765 Score = 129 bits (323), Expect = 4e-32 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV Sbjct: 704 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 762 >AOT81870.1 beta-amyrin synthase [Glycyrrhiza inflata] AOT81871.1 beta-amyrin synthase [Glycyrrhiza inflata] Length = 762 Score = 127 bits (319), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP 214 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP Sbjct: 704 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP 761 >ACV21067.1 beta-amyrin synthase [Glycyrrhiza uralensis] Length = 762 Score = 127 bits (319), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP 214 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP Sbjct: 704 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP 761 >ADE88148.1 beta-amyrin synthase [Glycyrrhiza uralensis] AOT81869.1 beta-amyrin synthase [Glycyrrhiza uralensis] Length = 762 Score = 127 bits (319), Expect = 1e-31 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP 214 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP Sbjct: 704 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTP 761 >GAU16151.1 hypothetical protein TSUD_297810 [Trifolium subterraneum] Length = 493 Score = 124 bits (310), Expect = 8e-31 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYP+WALAEYRRRVPLPST V Sbjct: 435 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRVPLPSTAV 493 >NP_001236591.1 beta-amyrin synthase [Glycine max] AAM23264.1 beta-amyrin synthase [Glycine max] Length = 739 Score = 125 bits (313), Expect = 9e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPST V Sbjct: 681 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTEV 739 >AAO33579.1 putative beta-amyrin synthase, partial [Lotus japonicus] Length = 750 Score = 125 bits (313), Expect = 9e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPST V Sbjct: 692 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTAV 750 >BAE53429.1 beta-amyrin synthase [Lotus japonicus] Length = 762 Score = 125 bits (313), Expect = 9e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPST V Sbjct: 704 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTAV 762 >AHI17180.1 beta-amyrin synthase, partial [Glycine max] Length = 762 Score = 125 bits (313), Expect = 9e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPST V Sbjct: 704 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTEV 762 >XP_006582958.1 PREDICTED: beta-amyrin synthase isoform X1 [Glycine max] KRH46975.1 hypothetical protein GLYMA_07G001300 [Glycine max] Length = 762 Score = 125 bits (313), Expect = 9e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPST V Sbjct: 704 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTEV 762 >XP_003531781.1 PREDICTED: beta-amyrin synthase [Glycine max] KRH44692.1 hypothetical protein GLYMA_08G225800 [Glycine max] Length = 762 Score = 125 bits (313), Expect = 9e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPST V Sbjct: 704 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTEV 762 >KHN39383.1 Beta-amyrin synthase [Glycine soja] Length = 773 Score = 125 bits (313), Expect = 9e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPST V Sbjct: 715 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTEV 773 >KHN38108.1 Beta-amyrin synthase [Glycine soja] Length = 783 Score = 125 bits (313), Expect = 9e-31 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPST V Sbjct: 725 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTEV 783 >XP_004488915.1 PREDICTED: beta-amyrin synthase [Cicer arietinum] Length = 762 Score = 124 bits (310), Expect = 2e-30 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYP+WALAEYRRRVPLPST V Sbjct: 704 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRVPLPSTTV 762 >XP_003604121.1 beta-amyrin synthase [Medicago truncatula] CAD23247.1 beta-amyrin synthase [Medicago truncatula] AES86318.1 beta-amyrin synthase [Medicago truncatula] Length = 762 Score = 124 bits (310), Expect = 2e-30 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYP+WALAEYRRRVPLPST V Sbjct: 704 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRVPLPSTAV 762 >AAO33578.1 beta-amyrin synthase [Medicago truncatula] Length = 762 Score = 124 bits (310), Expect = 2e-30 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYP+WALAEYRRRVPLPST V Sbjct: 704 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRVPLPSTAV 762 >XP_019456173.1 PREDICTED: beta-amyrin synthase isoform X2 [Lupinus angustifolius] Length = 761 Score = 121 bits (303), Expect = 2e-29 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPS 220 RAAKLI+NSQLE+GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPS Sbjct: 704 RAAKLIVNSQLEDGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPS 759 >XP_019456165.1 PREDICTED: beta-amyrin synthase isoform X1 [Lupinus angustifolius] XP_019456166.1 PREDICTED: beta-amyrin synthase isoform X1 [Lupinus angustifolius] XP_019456167.1 PREDICTED: beta-amyrin synthase isoform X1 [Lupinus angustifolius] XP_019456168.1 PREDICTED: beta-amyrin synthase isoform X1 [Lupinus angustifolius] XP_019456169.1 PREDICTED: beta-amyrin synthase isoform X1 [Lupinus angustifolius] XP_019456170.1 PREDICTED: beta-amyrin synthase isoform X1 [Lupinus angustifolius] XP_019456172.1 PREDICTED: beta-amyrin synthase isoform X1 [Lupinus angustifolius] Length = 762 Score = 121 bits (303), Expect = 2e-29 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPS 220 RAAKLI+NSQLE+GDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPS Sbjct: 704 RAAKLIVNSQLEDGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPS 759 >KYP53858.1 Beta-amyrin synthase [Cajanus cajan] Length = 760 Score = 119 bits (299), Expect = 7e-29 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPS 220 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEY RRVPLPS Sbjct: 702 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYCRRVPLPS 757 >XP_007135871.1 hypothetical protein PHAVU_010G165100g [Phaseolus vulgaris] ESW07865.1 hypothetical protein PHAVU_010G165100g [Phaseolus vulgaris] Length = 763 Score = 119 bits (299), Expect = 7e-29 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = -2 Query: 387 RAAKLIINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTPV 211 RAAKL+INSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRV LPS V Sbjct: 704 RAAKLLINSQLEEGDWPQQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVSLPSAGV 762