BLASTX nr result
ID: Glycyrrhiza28_contig00019355
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00019355 (389 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003606465.1 hypothetical protein MTR_4g060630 [Medicago trunc... 73 4e-14 XP_003607872.1 hypothetical protein MTR_4g083930 [Medicago trunc... 52 1e-06 >XP_003606465.1 hypothetical protein MTR_4g060630 [Medicago truncatula] AES88662.1 hypothetical protein MTR_4g060630 [Medicago truncatula] Length = 129 Score = 73.2 bits (178), Expect = 4e-14 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = -3 Query: 387 GMAMGRVL*YSSTYPRFKKISIPRPILAWVATLIPLPLLFGYLSTRTRANYTHFNFENS 211 GMAMGRVL S YP FKK+ +P P+ +W TL+ P+ +GYLS TR +Y HFN+E + Sbjct: 64 GMAMGRVLQCPSPYPHFKKLPVPVPVPSWETTLVSFPISYGYLSVHTRTHYPHFNYEKT 122 >XP_003607872.1 hypothetical protein MTR_4g083930 [Medicago truncatula] AES90069.1 hypothetical protein MTR_4g083930 [Medicago truncatula] Length = 69 Score = 52.4 bits (124), Expect = 1e-06 Identities = 30/55 (54%), Positives = 32/55 (58%) Frame = +3 Query: 216 FQS*SACNWHGYGYLGTQKVRVRGSKLLPMRVWVWVWIFF*IAGMWTSTIAPYPL 380 F A N GYGYL T +V RG KLLP RV V IFF AGM T + PYPL Sbjct: 8 FYGSGAGNGCGYGYLSTHRVWGRGLKLLPTRVRARVRIFFINAGMGTDIVVPYPL 62