BLASTX nr result
ID: Glycyrrhiza28_contig00018970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018970 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003612032.1 ubiquitin-protein ligase [Medicago truncatula] AE... 119 2e-29 XP_003612031.2 ubiquitin-protein ligase [Medicago truncatula] AE... 119 2e-29 XP_004512054.1 PREDICTED: U-box domain-containing protein 5-like... 115 3e-28 KYP66776.1 U-box domain-containing protein 5, partial [Cajanus c... 112 4e-27 XP_014521311.1 PREDICTED: U-box domain-containing protein 5-like... 100 1e-22 XP_006590691.1 PREDICTED: U-box domain-containing protein 5-like... 100 2e-22 KHN41968.1 U-box domain-containing protein 5 [Glycine soja] 100 2e-22 GAU18527.1 hypothetical protein TSUD_233990 [Trifolium subterran... 97 2e-21 OIV94801.1 hypothetical protein TanjilG_21998 [Lupinus angustifo... 93 2e-21 KOM45158.1 hypothetical protein LR48_Vigan06g046400 [Vigna angul... 95 7e-21 XP_017427943.1 PREDICTED: U-box domain-containing protein 5-like... 95 7e-21 XP_019421056.1 PREDICTED: U-box domain-containing protein 5 [Lup... 93 3e-20 KHN36106.1 U-box domain-containing protein 5 [Glycine soja] 90 5e-19 XP_003516568.2 PREDICTED: U-box domain-containing protein 5-like... 90 5e-19 XP_007156954.1 hypothetical protein PHAVU_002G031400g [Phaseolus... 89 1e-18 XP_016201867.1 PREDICTED: U-box domain-containing protein 5 [Ara... 82 4e-16 XP_015964165.1 PREDICTED: U-box domain-containing protein 5 [Ara... 82 4e-16 XP_003519896.1 PREDICTED: U-box domain-containing protein 5-like... 67 5e-11 KHN00532.1 U-box domain-containing protein 5 [Glycine soja] 67 5e-11 XP_004509274.1 PREDICTED: U-box domain-containing protein 5 [Cic... 67 7e-11 >XP_003612032.1 ubiquitin-protein ligase [Medicago truncatula] AES94990.1 ubiquitin-protein ligase [Medicago truncatula] Length = 767 Score = 119 bits (298), Expect = 2e-29 Identities = 62/84 (73%), Positives = 70/84 (83%) Frame = -2 Query: 271 PLFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSS 92 PLF+ISQNGNDKGKE ALELLH+LRDA K VENED SS+P TNN+S DSN+ PEENRSS Sbjct: 686 PLFYISQNGNDKGKESALELLHILRDA--KYVENEDRSSQPITNNSSTDSNSHPEENRSS 743 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K+S FLKKL LFSK + HA K +R Sbjct: 744 KKSQFLKKLGLFSKSTPHASKPRR 767 >XP_003612031.2 ubiquitin-protein ligase [Medicago truncatula] AES94989.2 ubiquitin-protein ligase [Medicago truncatula] Length = 782 Score = 119 bits (298), Expect = 2e-29 Identities = 62/84 (73%), Positives = 70/84 (83%) Frame = -2 Query: 271 PLFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSS 92 PLF+ISQNGNDKGKE ALELLH+LRDA K VENED SS+P TNN+S DSN+ PEENRSS Sbjct: 701 PLFYISQNGNDKGKESALELLHILRDA--KYVENEDRSSQPITNNSSTDSNSHPEENRSS 758 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K+S FLKKL LFSK + HA K +R Sbjct: 759 KKSQFLKKLGLFSKSTPHASKPRR 782 >XP_004512054.1 PREDICTED: U-box domain-containing protein 5-like [Cicer arietinum] Length = 762 Score = 115 bits (289), Expect = 3e-28 Identities = 66/84 (78%), Positives = 70/84 (83%) Frame = -2 Query: 271 PLFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSS 92 PLF+IS NG+DKGKE ALELLH+LRDA K VENED SSEP T NTSRDSN+ EENRSS Sbjct: 685 PLFYISLNGSDKGKESALELLHILRDA--KYVENEDSSSEPIT-NTSRDSNSHHEENRSS 741 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 KRSPFLK LFSKPSSHA KTKR Sbjct: 742 KRSPFLK---LFSKPSSHAAKTKR 762 >KYP66776.1 U-box domain-containing protein 5, partial [Cajanus cajan] Length = 708 Score = 112 bits (281), Expect = 4e-27 Identities = 63/83 (75%), Positives = 67/83 (80%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSSK 89 L +ISQNGNDKGKE A ELL+LL D N VENEDC EPN NNTSRDSN+ EEN+ SK Sbjct: 629 LCYISQNGNDKGKESASELLNLLGDVKN-VVENEDCP-EPNINNTSRDSNSRTEENKPSK 686 Query: 88 RSPFLKKLPLFSKPSSHAPKTKR 20 RS FLKKLPLFSK SSHAPKTKR Sbjct: 687 RS-FLKKLPLFSKSSSHAPKTKR 708 >XP_014521311.1 PREDICTED: U-box domain-containing protein 5-like [Vigna radiata var. radiata] XP_014521312.1 PREDICTED: U-box domain-containing protein 5-like [Vigna radiata var. radiata] Length = 757 Score = 100 bits (248), Expect = 1e-22 Identities = 55/84 (65%), Positives = 64/84 (76%), Gaps = 1/84 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNT-PPEENRSS 92 LF ISQNGNDKGK+ ALEL+HLL D + +N+DC EPNT+N+ RDSNT PPEENR Sbjct: 677 LFLISQNGNDKGKKSALELIHLLDDVN--IGDNKDCP-EPNTSNSCRDSNTHPPEENRPL 733 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K+S FLKKL FSK SSH K+KR Sbjct: 734 KKSTFLKKLSPFSKSSSHGSKSKR 757 >XP_006590691.1 PREDICTED: U-box domain-containing protein 5-like [Glycine max] XP_014619366.1 PREDICTED: U-box domain-containing protein 5-like [Glycine max] XP_014619367.1 PREDICTED: U-box domain-containing protein 5-like [Glycine max] KRH28688.1 hypothetical protein GLYMA_11G069300 [Glycine max] Length = 761 Score = 99.8 bits (247), Expect = 2e-22 Identities = 56/84 (66%), Positives = 63/84 (75%), Gaps = 1/84 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNT-PPEENRSS 92 L +ISQNGND+GK ALELLHLL+D ENE C EPN NN+SRDSN+ PEEN+ S Sbjct: 681 LIYISQNGNDRGKGSALELLHLLKDID--IAENEGCP-EPNINNSSRDSNSYHPEENQPS 737 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K+S FLKKL FSK SSHA KTKR Sbjct: 738 KKSTFLKKLSPFSKSSSHASKTKR 761 >KHN41968.1 U-box domain-containing protein 5 [Glycine soja] Length = 771 Score = 99.8 bits (247), Expect = 2e-22 Identities = 56/84 (66%), Positives = 63/84 (75%), Gaps = 1/84 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNT-PPEENRSS 92 L +ISQNGND+GK ALELLHLL+D ENE C EPN NN+SRDSN+ PEEN+ S Sbjct: 691 LIYISQNGNDRGKGSALELLHLLKDID--IAENEGCP-EPNINNSSRDSNSYHPEENQPS 747 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K+S FLKKL FSK SSHA KTKR Sbjct: 748 KKSTFLKKLSPFSKSSSHASKTKR 771 >GAU18527.1 hypothetical protein TSUD_233990 [Trifolium subterraneum] Length = 761 Score = 96.7 bits (239), Expect = 2e-21 Identities = 54/74 (72%), Positives = 62/74 (83%), Gaps = 1/74 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDC-SSEPNTNNTSRDSNTPPEENRSS 92 LF+ISQNGNDKGKE ALELL +L+DA K VENE+ SS+P TNNTS +S++ EENRSS Sbjct: 687 LFYISQNGNDKGKETALELLQILKDA--KDVENEENRSSQPITNNTSGESSSHTEENRSS 744 Query: 91 KRSPFLKKLPLFSK 50 KRSPFLKKL LFSK Sbjct: 745 KRSPFLKKLGLFSK 758 >OIV94801.1 hypothetical protein TanjilG_21998 [Lupinus angustifolius] Length = 242 Score = 93.2 bits (230), Expect = 2e-21 Identities = 50/84 (59%), Positives = 60/84 (71%) Frame = -2 Query: 271 PLFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSS 92 PL +IS+NGNDKGK A+ELL LLRD VENEDC EPN N +N PP+E ++S Sbjct: 162 PLAYISKNGNDKGKAIAMELLRLLRDIDY--VENEDCL-EPNLNTPQDSNNHPPQEKKTS 218 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K + F+KKL LFSK SSHA K+KR Sbjct: 219 KGASFMKKLSLFSKSSSHASKSKR 242 >KOM45158.1 hypothetical protein LR48_Vigan06g046400 [Vigna angularis] Length = 747 Score = 95.1 bits (235), Expect = 7e-21 Identities = 53/84 (63%), Positives = 62/84 (73%), Gaps = 1/84 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNT-PPEENRSS 92 LF ISQNGNDKGK+ ALEL+HLL D + +N+DC EPN +N+ RDSNT P EENR Sbjct: 667 LFLISQNGNDKGKKSALELIHLLDDVN--IGDNKDCP-EPNISNSCRDSNTHPAEENRPP 723 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K+S FLKKL FSK SSH K+KR Sbjct: 724 KKSTFLKKLSPFSKSSSHGSKSKR 747 >XP_017427943.1 PREDICTED: U-box domain-containing protein 5-like [Vigna angularis] BAU00066.1 hypothetical protein VIGAN_10162700 [Vigna angularis var. angularis] Length = 757 Score = 95.1 bits (235), Expect = 7e-21 Identities = 53/84 (63%), Positives = 62/84 (73%), Gaps = 1/84 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNT-PPEENRSS 92 LF ISQNGNDKGK+ ALEL+HLL D + +N+DC EPN +N+ RDSNT P EENR Sbjct: 677 LFLISQNGNDKGKKSALELIHLLDDVN--IGDNKDCP-EPNISNSCRDSNTHPAEENRPP 733 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K+S FLKKL FSK SSH K+KR Sbjct: 734 KKSTFLKKLSPFSKSSSHGSKSKR 757 >XP_019421056.1 PREDICTED: U-box domain-containing protein 5 [Lupinus angustifolius] XP_019421057.1 PREDICTED: U-box domain-containing protein 5 [Lupinus angustifolius] XP_019421058.1 PREDICTED: U-box domain-containing protein 5 [Lupinus angustifolius] Length = 759 Score = 93.2 bits (230), Expect = 3e-20 Identities = 50/84 (59%), Positives = 60/84 (71%) Frame = -2 Query: 271 PLFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSS 92 PL +IS+NGNDKGK A+ELL LLRD VENEDC EPN N +N PP+E ++S Sbjct: 679 PLAYISKNGNDKGKAIAMELLRLLRDIDY--VENEDCL-EPNLNTPQDSNNHPPQEKKTS 735 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 K + F+KKL LFSK SSHA K+KR Sbjct: 736 KGASFMKKLSLFSKSSSHASKSKR 759 >KHN36106.1 U-box domain-containing protein 5 [Glycine soja] Length = 756 Score = 89.7 bits (221), Expect = 5e-19 Identities = 51/84 (60%), Positives = 60/84 (71%), Gaps = 1/84 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNT-PPEENRSS 92 LF+ISQNGNDKGKE ALEL +LL+D N++C EPN NN+ RDSN+ EE + Sbjct: 676 LFYISQNGNDKGKESALELFYLLKDVD--IAVNKNC-PEPNINNSCRDSNSHDREEKKPL 732 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 KRS FLKKL FSK SSHA K+KR Sbjct: 733 KRSTFLKKLSQFSKSSSHATKSKR 756 >XP_003516568.2 PREDICTED: U-box domain-containing protein 5-like [Glycine max] KRH76779.1 hypothetical protein GLYMA_01G173800 [Glycine max] Length = 762 Score = 89.7 bits (221), Expect = 5e-19 Identities = 51/84 (60%), Positives = 60/84 (71%), Gaps = 1/84 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNT-PPEENRSS 92 LF+ISQNGNDKGKE ALEL +LL+D N++C EPN NN+ RDSN+ EE + Sbjct: 682 LFYISQNGNDKGKESALELFYLLKDVD--IAVNKNC-PEPNINNSCRDSNSHDREEKKPL 738 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 KRS FLKKL FSK SSHA K+KR Sbjct: 739 KRSTFLKKLSQFSKSSSHATKSKR 762 >XP_007156954.1 hypothetical protein PHAVU_002G031400g [Phaseolus vulgaris] XP_007156955.1 hypothetical protein PHAVU_002G031400g [Phaseolus vulgaris] XP_007156956.1 hypothetical protein PHAVU_002G031400g [Phaseolus vulgaris] ESW28948.1 hypothetical protein PHAVU_002G031400g [Phaseolus vulgaris] ESW28949.1 hypothetical protein PHAVU_002G031400g [Phaseolus vulgaris] ESW28950.1 hypothetical protein PHAVU_002G031400g [Phaseolus vulgaris] Length = 758 Score = 89.0 bits (219), Expect = 1e-18 Identities = 50/84 (59%), Positives = 62/84 (73%), Gaps = 1/84 (1%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDS-NTPPEENRSS 92 L ISQNGNDKGK+ A+EL+++L + V+N+ C EPN +N+ RDS + PPEE+R S Sbjct: 678 LCLISQNGNDKGKKSAMELIYILNGVN--IVDNKGCP-EPNISNSCRDSISHPPEESRPS 734 Query: 91 KRSPFLKKLPLFSKPSSHAPKTKR 20 KRS FLKKL FSK SSHA KTKR Sbjct: 735 KRSTFLKKLSPFSKSSSHASKTKR 758 >XP_016201867.1 PREDICTED: U-box domain-containing protein 5 [Arachis ipaensis] Length = 751 Score = 81.6 bits (200), Expect = 4e-16 Identities = 48/83 (57%), Positives = 58/83 (69%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSSK 89 LF+IS+NG+DKG+ ALELL LL+D + VE++D S EPN NNTS DSN+ P+E RSSK Sbjct: 680 LFYISKNGSDKGQATALELLRLLQDVED--VEDDD-SLEPNLNNTSGDSNSQPQERRSSK 736 Query: 88 RSPFLKKLPLFSKPSSHAPKTKR 20 S FLKKLP KTKR Sbjct: 737 GSKFLKKLPFL--------KTKR 751 >XP_015964165.1 PREDICTED: U-box domain-containing protein 5 [Arachis duranensis] Length = 751 Score = 81.6 bits (200), Expect = 4e-16 Identities = 48/83 (57%), Positives = 58/83 (69%) Frame = -2 Query: 268 LFFISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSSK 89 LF+IS+NG+DKG+ ALELL LL+D + VE++D S EPN NNTS DSN+ P+E RSSK Sbjct: 680 LFYISKNGSDKGQATALELLRLLQDVED--VEDDD-SLEPNLNNTSGDSNSQPQERRSSK 736 Query: 88 RSPFLKKLPLFSKPSSHAPKTKR 20 S FLKKLP KTKR Sbjct: 737 GSKFLKKLPFL--------KTKR 751 >XP_003519896.1 PREDICTED: U-box domain-containing protein 5-like [Glycine max] XP_014620644.1 PREDICTED: U-box domain-containing protein 5-like [Glycine max] KRH69900.1 hypothetical protein GLYMA_02G055500 [Glycine max] Length = 760 Score = 67.0 bits (162), Expect = 5e-11 Identities = 41/80 (51%), Positives = 48/80 (60%) Frame = -2 Query: 259 ISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSSKRSP 80 IS G+D K ALELL LL+ S E EDC EPN N + +N +E +SSK+ Sbjct: 684 ISNKGSDMAKAYALELLRLLKGDSE--FEYEDCC-EPNLNGSQEPNNNHYQEKKSSKKPS 740 Query: 79 FLKKLPLFSKPSSHAPKTKR 20 LKKL LFSK S APKTKR Sbjct: 741 ILKKLSLFSKSISVAPKTKR 760 >KHN00532.1 U-box domain-containing protein 5 [Glycine soja] Length = 816 Score = 67.0 bits (162), Expect = 5e-11 Identities = 41/80 (51%), Positives = 48/80 (60%) Frame = -2 Query: 259 ISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSSKRSP 80 IS G+D K ALELL LL+ S E EDC EPN N + +N +E +SSK+ Sbjct: 740 ISNKGSDMAKAYALELLRLLKGDSE--FEYEDCC-EPNLNGSQEPNNNHYQEKKSSKKPS 796 Query: 79 FLKKLPLFSKPSSHAPKTKR 20 LKKL LFSK S APKTKR Sbjct: 797 ILKKLSLFSKSISVAPKTKR 816 >XP_004509274.1 PREDICTED: U-box domain-containing protein 5 [Cicer arietinum] Length = 759 Score = 66.6 bits (161), Expect = 7e-11 Identities = 45/80 (56%), Positives = 50/80 (62%) Frame = -2 Query: 259 ISQNGNDKGKERALELLHLLRDASNKCVENEDCSSEPNTNNTSRDSNTPPEENRSSKRSP 80 IS GND K ALELL LLRD V +E C EPN NN S+DSN EEN+ SK+S Sbjct: 687 ISNMGNDSTKAYALELLRLLRD-----VASEGCF-EPNLNN-SQDSNDHFEENKLSKKST 739 Query: 79 FLKKLPLFSKPSSHAPKTKR 20 LKKL FSK SS + K KR Sbjct: 740 ILKKLSWFSKSSSVSSKNKR 759