BLASTX nr result
ID: Glycyrrhiza28_contig00018769
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018769 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN48906.1 Zinc finger protein CONSTANS-LIKE 3 [Glycine soja] 53 2e-06 XP_006598211.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4-li... 53 2e-06 >KHN48906.1 Zinc finger protein CONSTANS-LIKE 3 [Glycine soja] Length = 271 Score = 53.1 bits (126), Expect = 2e-06 Identities = 37/77 (48%), Positives = 45/77 (58%), Gaps = 1/77 (1%) Frame = -1 Query: 232 QDGLLMPILDDDNSNSNNGALDHIVSSVLDCDVMYSSAAWMPNSAGFSNSDINQQLDHLV 53 QD L +P+LD NNGALDHIVS LDCD M +A WMP+ ++QL L Sbjct: 45 QDSLSIPVLD-----MNNGALDHIVS--LDCDTMACAANWMPS--------FSEQLGGLS 89 Query: 52 -MPISDSCSKMGFLGGG 5 + ISD K+GF GGG Sbjct: 90 DLAISD--CKIGFYGGG 104 >XP_006598211.1 PREDICTED: zinc finger protein CONSTANS-LIKE 4-like [Glycine max] KRH13707.1 hypothetical protein GLYMA_15G258200 [Glycine max] Length = 278 Score = 53.1 bits (126), Expect = 2e-06 Identities = 37/77 (48%), Positives = 45/77 (58%), Gaps = 1/77 (1%) Frame = -1 Query: 232 QDGLLMPILDDDNSNSNNGALDHIVSSVLDCDVMYSSAAWMPNSAGFSNSDINQQLDHLV 53 QD L +P+LD NNGALDHIVS LDCD M +A WMP+ ++QL L Sbjct: 52 QDSLSIPVLD-----MNNGALDHIVS--LDCDTMACAANWMPS--------FSEQLGGLS 96 Query: 52 -MPISDSCSKMGFLGGG 5 + ISD K+GF GGG Sbjct: 97 DLAISD--CKIGFYGGG 111