BLASTX nr result
ID: Glycyrrhiza28_contig00018763
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018763 (439 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_056238480.1 hypothetical protein [Methylobacterium sp. Leaf45... 67 2e-10 WP_056238441.1 hypothetical protein [Methylobacterium sp. Leaf45... 64 7e-10 SFK56067.1 VCBS repeat-containing protein [Methylobacterium sals... 65 1e-09 WP_056243505.1 hypothetical protein [Methylobacterium sp. Leaf45... 62 1e-09 WP_056249857.1 hypothetical protein [Methylobacterium sp. Leaf45... 65 2e-09 SFK80664.1 serralysin [Methylobacterium salsuginis] 63 8e-09 WP_056238483.1 hypothetical protein [Methylobacterium sp. Leaf45... 62 2e-08 WP_056243572.1 hypothetical protein [Methylobacterium sp. Leaf45... 62 2e-08 WP_056242416.1 hypothetical protein [Methylobacterium sp. Leaf45... 62 2e-08 WP_056454630.1 hypothetical protein [Methylobacterium sp. Leaf86... 58 4e-08 WP_056258829.1 hypothetical protein [Methylobacterium sp. Leaf93... 60 4e-08 WP_056248157.1 hypothetical protein [Methylobacterium sp. Leaf45... 61 5e-08 WP_055884791.1 hypothetical protein [Methylobacterium sp. Leaf39... 61 5e-08 WP_056241211.1 hypothetical protein [Methylobacterium sp. Leaf45... 60 5e-08 WP_051439935.1 hypothetical protein [Methylobacterium sp. 10] 60 7e-08 WP_055883028.1 hypothetical protein [Methylobacterium sp. Leaf39... 60 7e-08 SFL92110.1 Ca2+-binding protein, RTX toxin-related [Methylobacte... 60 9e-08 WP_055886534.1 hypothetical protein [Methylobacterium sp. Leaf39... 59 1e-07 WP_055883044.1 hypothetical protein [Methylobacterium sp. Leaf39... 58 1e-07 WP_056283826.1 hypothetical protein [Methylobacterium sp. Leaf10... 58 1e-07 >WP_056238480.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT60780.1 hypothetical protein ASG52_16100 [Methylobacterium sp. Leaf456] Length = 412 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPL 16 TFVFATALGA NVDRITDF+ DT+RLSKS+F+ALAPG L Sbjct: 313 TFVFATALGAGNVDRITDFSAVDTIRLSKSIFSALAPGEL 352 >WP_056238441.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT60766.1 hypothetical protein ASG52_16030 [Methylobacterium sp. Leaf456] Length = 156 Score = 63.5 bits (153), Expect = 7e-10 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPLAQTA 4 TF+FA ALGA NVDRITDFA DT+ L K VF ALAPG LA++A Sbjct: 57 TFIFANALGADNVDRITDFASNDTIWLGKGVFTALAPGQLAESA 100 >SFK56067.1 VCBS repeat-containing protein [Methylobacterium salsuginis] Length = 772 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPLAQTA 4 TFVF+TAL A+NVDRI DFA EDT+RL KS+ +ALAPG LA++A Sbjct: 673 TFVFSTALQASNVDRIADFAAEDTIRLGKSIVSALAPGELAESA 716 >WP_056243505.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT56090.1 hypothetical protein ASG52_24535 [Methylobacterium sp. Leaf456] Length = 125 Score = 62.0 bits (149), Expect = 1e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPLAQTA 4 TF+FA+ALG NVDR+TDFA DT+ L K VF ALAPG LA++A Sbjct: 26 TFIFASALGTDNVDRVTDFASNDTIWLGKGVFTALAPGQLAESA 69 >WP_056249857.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT45622.1 hypothetical protein ASG52_15880 [Methylobacterium sp. Leaf456] Length = 1000 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPLAQTAL 1 TF+FA+ALGA NVDRITDF+ DT+RLSKS FAA+APG L L Sbjct: 901 TFIFASALGAGNVDRITDFSAVDTIRLSKSFFAAIAPGQLKANEL 945 >SFK80664.1 serralysin [Methylobacterium salsuginis] Length = 640 Score = 63.2 bits (152), Expect = 8e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPL 16 TFVFAT LG NVD I DFA EDT+RLSKS+F+ALAPG L Sbjct: 541 TFVFATTLGRGNVDHIVDFATEDTIRLSKSLFSALAPGEL 580 >WP_056238483.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT60781.1 hypothetical protein ASG52_16105 [Methylobacterium sp. Leaf456] Length = 678 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPL 16 TFVF+T LGA NVDRITDF+ D +RLSKS+F+ALAPG + Sbjct: 579 TFVFSTVLGAGNVDRITDFSTVDAIRLSKSIFSALAPGEI 618 >WP_056243572.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT55411.1 hypothetical protein ASG52_24725 [Methylobacterium sp. Leaf456] Length = 1065 Score = 62.0 bits (149), Expect = 2e-08 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDF-AVEDTVRLSKSVFAALAPGPLAQTA 4 TFVFATALGA NVDRITDF A +DT++LSKS+F AL+ G LA +A Sbjct: 963 TFVFATALGAGNVDRITDFSAADDTIQLSKSIFTALSGGTLAASA 1007 >WP_056242416.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT57633.1 hypothetical protein ASG52_23705 [Methylobacterium sp. Leaf456] Length = 1857 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPLAQTA 4 TFVF+T G+ N+D ITDFAVEDT++L+KSVFAALAPG L A Sbjct: 1756 TFVFSTQPGSTNLDHITDFAVEDTIQLAKSVFAALAPGKLLDGA 1799 >WP_056454630.1 hypothetical protein [Methylobacterium sp. Leaf86] KQO49169.1 hypothetical protein ASF24_08320 [Methylobacterium sp. Leaf86] Length = 128 Score = 58.2 bits (139), Expect = 4e-08 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPLAQTA 4 TFVF+TALG++N+DR+TDFA +DT++L++ F AL+ G LA +A Sbjct: 26 TFVFSTALGSSNIDRLTDFAADDTIQLARDGFTALSAGDLASSA 69 >WP_056258829.1 hypothetical protein [Methylobacterium sp. Leaf93] KQP02752.1 hypothetical protein ASF26_15095 [Methylobacterium sp. Leaf93] Length = 212 Score = 59.7 bits (143), Expect = 4e-08 Identities = 29/45 (64%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDF-AVEDTVRLSKSVFAALAPGPLAQTA 4 TFVF+T LG +N+D +TDF A++DT++LSKSVFAAL+ GPLA +A Sbjct: 107 TFVFSTKLGFSNIDHVTDFSALDDTIQLSKSVFAALSAGPLAVSA 151 >WP_056248157.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT46595.1 hypothetical protein ASG52_12815 [Methylobacterium sp. Leaf456] Length = 502 Score = 60.8 bits (146), Expect = 5e-08 Identities = 31/45 (68%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDF-AVEDTVRLSKSVFAALAPGPLAQTA 4 TFVF+TALGA NVDRITDF A +DT++LSKS+F AL+ G LA +A Sbjct: 396 TFVFSTALGAGNVDRITDFSAADDTIQLSKSIFTALSGGTLAASA 440 >WP_055884791.1 hypothetical protein [Methylobacterium sp. Leaf399] KQT14485.1 hypothetical protein ASG40_19150 [Methylobacterium sp. Leaf399] Length = 1505 Score = 60.8 bits (146), Expect = 5e-08 Identities = 30/45 (66%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAV-EDTVRLSKSVFAALAPGPLAQTA 4 TF F+T LGA NVDRI+DF+V +DT++L++SVFAAL GPLA TA Sbjct: 1404 TFAFSTGLGAGNVDRISDFSVPDDTIQLARSVFAALGAGPLAATA 1448 >WP_056241211.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT58691.1 hypothetical protein ASG52_21415 [Methylobacterium sp. Leaf456] Length = 330 Score = 60.5 bits (145), Expect = 5e-08 Identities = 31/45 (68%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDF-AVEDTVRLSKSVFAALAPGPLAQTA 4 TFVF+TALGA NVDRITDF A +DT++LSK +FAAL+ G LA A Sbjct: 228 TFVFSTALGAGNVDRITDFSAADDTIQLSKGIFAALSAGTLAALA 272 >WP_051439935.1 hypothetical protein [Methylobacterium sp. 10] Length = 666 Score = 60.5 bits (145), Expect = 7e-08 Identities = 31/45 (68%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDF-AVEDTVRLSKSVFAALAPGPLAQTA 4 TFVF+T LGA N+D ITDF A++DT++LSKSVFAAL+ G LA TA Sbjct: 561 TFVFSTKLGATNIDHITDFSAMDDTIQLSKSVFAALSAGDLAVTA 605 >WP_055883028.1 hypothetical protein [Methylobacterium sp. Leaf399] KQT16160.1 hypothetical protein ASG40_18130 [Methylobacterium sp. Leaf399] Length = 313 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/45 (66%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFA-VEDTVRLSKSVFAALAPGPLAQTA 4 TFVF TALG +N+DRITDF+ V+DTV+L++SVF AL GPLA+ A Sbjct: 212 TFVFRTALGPSNLDRITDFSVVDDTVQLARSVFTALGAGPLAEAA 256 >SFL92110.1 Ca2+-binding protein, RTX toxin-related [Methylobacterium salsuginis] Length = 1072 Score = 60.1 bits (144), Expect = 9e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFAVEDTVRLSKSVFAALAPGPLAQTA 4 +F F+TALG NVD + DFA EDTVRLSKSVF+AL+ G LA A Sbjct: 971 SFAFSTALGTGNVDHLVDFATEDTVRLSKSVFSALSAGSLAAAA 1014 >WP_055886534.1 hypothetical protein [Methylobacterium sp. Leaf399] KQT10531.1 hypothetical protein ASG40_20115 [Methylobacterium sp. Leaf399] Length = 202 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFA-VEDTVRLSKSVFAALAPGPLAQTA 4 TFVF TALG+ N+DRI DF+ V+DTV+L++SVF AL GPLA+ A Sbjct: 101 TFVFRTALGSGNLDRIADFSVVDDTVQLTRSVFTALGAGPLAEAA 145 >WP_055883044.1 hypothetical protein [Methylobacterium sp. Leaf399] KQT16168.1 hypothetical protein ASG40_18180 [Methylobacterium sp. Leaf399] Length = 193 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFA-VEDTVRLSKSVFAALAPGPLAQTA 4 TF+F TALG AN+DRI DF+ V+DTV+L++SVF AL GPLA+ A Sbjct: 92 TFMFRTALGPANLDRIADFSVVDDTVQLARSVFTALGAGPLAEAA 136 >WP_056283826.1 hypothetical protein [Methylobacterium sp. Leaf108] KQP53642.1 hypothetical protein ASF39_19935 [Methylobacterium sp. Leaf108] Length = 193 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -2 Query: 135 TFVFATALGAANVDRITDFA-VEDTVRLSKSVFAALAPGPLAQTA 4 +FVF TALG N+DRITDF+ V+DTV+L++SVF AL GPLA+ A Sbjct: 92 SFVFRTALGPTNLDRITDFSVVDDTVQLARSVFTALGAGPLAEAA 136