BLASTX nr result
ID: Glycyrrhiza28_contig00018543
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018543 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAA54250.1 tumor differentially expressed protein [Clonorchis si... 67 6e-13 ACH48223.1 tumor differentially expressed protein [Haplopelma sc... 67 1e-12 WP_071289901.1 hypothetical protein [Acinetobacter baumannii] OI... 64 3e-11 EKC17739.1 hypothetical protein CGI_10000276 [Crassostrea gigas]... 63 4e-11 ADV40298.1 putative tumor differentially expressed protein [Latr... 62 6e-11 EEC70730.1 hypothetical protein OsI_02128 [Oryza sativa Indica G... 62 8e-11 XP_007415545.1 hypothetical protein MELLADRAFT_92715 [Melampsora... 61 1e-10 XP_007413087.1 hypothetical protein MELLADRAFT_90066 [Melampsora... 61 2e-10 XP_007418686.1 hypothetical protein MELLADRAFT_96218 [Melampsora... 61 2e-10 EKC17917.1 hypothetical protein CGI_10000048 [Crassostrea gigas] 63 2e-10 KMT14087.1 hypothetical protein BVRB_4g079120 [Beta vulgaris sub... 60 2e-10 XP_007413083.1 hypothetical protein MELLADRAFT_90060 [Melampsora... 61 2e-10 XP_007413092.1 hypothetical protein MELLADRAFT_90079 [Melampsora... 61 2e-10 EKC17856.1 hypothetical protein CGI_10000119 [Crassostrea gigas] 63 2e-10 XP_007405674.1 hypothetical protein MELLADRAFT_92520 [Melampsora... 61 3e-10 XP_007417435.1 hypothetical protein MELLADRAFT_94733 [Melampsora... 61 3e-10 KRH17766.1 hypothetical protein GLYMA_13G013900 [Glycine max] KR... 63 4e-10 XP_007417431.1 hypothetical protein MELLADRAFT_94729 [Melampsora... 61 4e-10 XP_007411822.1 hypothetical protein MELLADRAFT_88315 [Melampsora... 61 4e-10 XP_007405671.1 hypothetical protein MELLADRAFT_92514 [Melampsora... 61 5e-10 >GAA54250.1 tumor differentially expressed protein [Clonorchis sinensis] Length = 51 Score = 66.6 bits (161), Expect = 6e-13 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 161 PCAGDASFKFLPYQLSMVG*WPTMVVTGDGELGFDSGEG 277 PC GD SFK LPYQ SMVG PTMV+TG+GE GFDSGEG Sbjct: 12 PCVGDGSFKCLPYQFSMVGDLPTMVITGNGESGFDSGEG 50 >ACH48223.1 tumor differentially expressed protein [Haplopelma schmidti] Length = 77 Score = 66.6 bits (161), Expect = 1e-12 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 164 CAGDASFKFLPYQLSMVG*WPTMVVTGDGELGFDSGEG 277 C GDASFK LPYQLSMVG PTMVVTG+GE GFDSGEG Sbjct: 39 CPGDASFKCLPYQLSMVGYAPTMVVTGNGESGFDSGEG 76 >WP_071289901.1 hypothetical protein [Acinetobacter baumannii] OIF91489.1 hypothetical protein A7N06_19565 [Acinetobacter baumannii] Length = 92 Score = 63.5 bits (153), Expect = 3e-11 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +2 Query: 170 GDASFKFLPYQLSMVG*WPTMVVTGDGELGFDSGEG 277 GDASFK LPYQLSMVG PTMVVTG+GE GFDSGEG Sbjct: 56 GDASFKCLPYQLSMVGSAPTMVVTGNGESGFDSGEG 91 >EKC17739.1 hypothetical protein CGI_10000276 [Crassostrea gigas] EKC26884.1 hypothetical protein CGI_10000518 [Crassostrea gigas] EKC34384.1 hypothetical protein CGI_10017687 [Crassostrea gigas] Length = 77 Score = 62.8 bits (151), Expect = 4e-11 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +2 Query: 164 CAGDASFKFLPYQLSMVG*WPTMVVTGDGELGFDSGEG 277 C GD SFK LPYQLSMV PTMVVTG+GE GFDSGEG Sbjct: 39 CPGDVSFKCLPYQLSMVRAMPTMVVTGNGESGFDSGEG 76 >ADV40298.1 putative tumor differentially expressed protein [Latrodectus hesperus] Length = 77 Score = 62.4 bits (150), Expect = 6e-11 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +2 Query: 164 CAGDASFKFLPYQLSMVG*WPTMVVTGDGELGFDSGEG 277 C+GD SFK LPYQLSMV PTMVVTG+GE GFDSGEG Sbjct: 39 CSGDVSFKCLPYQLSMVCYAPTMVVTGNGESGFDSGEG 76 >EEC70730.1 hypothetical protein OsI_02128 [Oryza sativa Indica Group] Length = 67 Score = 61.6 bits (148), Expect = 8e-11 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 129 MIHDNSSDRTALVLATHHSNFCPINFRW 212 MIHDNS+DRTALV ATHHSNFCPINFRW Sbjct: 1 MIHDNSTDRTALVPATHHSNFCPINFRW 28 >XP_007415545.1 hypothetical protein MELLADRAFT_92715 [Melampsora larici-populina 98AG31] EGG01195.1 hypothetical protein MELLADRAFT_92715 [Melampsora larici-populina 98AG31] Length = 63 Score = 61.2 bits (147), Expect = 1e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 33 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 63 >XP_007413087.1 hypothetical protein MELLADRAFT_90066 [Melampsora larici-populina 98AG31] EGG03640.1 hypothetical protein MELLADRAFT_90066 [Melampsora larici-populina 98AG31] Length = 76 Score = 61.2 bits (147), Expect = 2e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 46 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 76 >XP_007418686.1 hypothetical protein MELLADRAFT_96218 [Melampsora larici-populina 98AG31] XP_007419490.1 hypothetical protein MELLADRAFT_86345 [Melampsora larici-populina 98AG31] EGF97239.1 hypothetical protein MELLADRAFT_86345 [Melampsora larici-populina 98AG31] EGF98047.1 hypothetical protein MELLADRAFT_96218 [Melampsora larici-populina 98AG31] Length = 78 Score = 61.2 bits (147), Expect = 2e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 48 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 78 >EKC17917.1 hypothetical protein CGI_10000048 [Crassostrea gigas] Length = 143 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +2 Query: 164 CAGDASFKFLPYQLSMVG*WPTMVVTGDGELGFDSGEG 277 C GD SFK LPYQLSMV PTMVVTG+GE GFDSGEG Sbjct: 105 CPGDVSFKCLPYQLSMVRAMPTMVVTGNGESGFDSGEG 142 >KMT14087.1 hypothetical protein BVRB_4g079120 [Beta vulgaris subsp. vulgaris] Length = 44 Score = 60.1 bits (144), Expect = 2e-10 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +3 Query: 126 LMIHDNSSDRTALVLATHHSNFCPINFRW 212 LMIHDNS+DRTA ATHHSNFCPINFRW Sbjct: 16 LMIHDNSTDRTAFAPATHHSNFCPINFRW 44 >XP_007413083.1 hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] EGG03636.1 hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] Length = 87 Score = 61.2 bits (147), Expect = 2e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 57 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 87 >XP_007413092.1 hypothetical protein MELLADRAFT_90079 [Melampsora larici-populina 98AG31] XP_007418191.1 hypothetical protein MELLADRAFT_95625 [Melampsora larici-populina 98AG31] EGF98539.1 hypothetical protein MELLADRAFT_95625 [Melampsora larici-populina 98AG31] EGG03645.1 hypothetical protein MELLADRAFT_90079 [Melampsora larici-populina 98AG31] Length = 88 Score = 61.2 bits (147), Expect = 2e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 58 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 88 >EKC17856.1 hypothetical protein CGI_10000119 [Crassostrea gigas] Length = 154 Score = 62.8 bits (151), Expect = 2e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +2 Query: 164 CAGDASFKFLPYQLSMVG*WPTMVVTGDGELGFDSGEG 277 C GD SFK LPYQLSMV PTMVVTG+GE GFDSGEG Sbjct: 116 CPGDVSFKCLPYQLSMVRAMPTMVVTGNGESGFDSGEG 153 >XP_007405674.1 hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] XP_007413435.1 hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] XP_007416289.1 hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] XP_007417784.1 hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] EGF98957.1 hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] EGG00443.1 hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] EGG03300.1 hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] EGG11072.1 hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] Length = 103 Score = 61.2 bits (147), Expect = 3e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 73 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 103 >XP_007417435.1 hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] EGF99318.1 hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] Length = 106 Score = 61.2 bits (147), Expect = 3e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 76 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 106 >KRH17766.1 hypothetical protein GLYMA_13G013900 [Glycine max] KRH17769.1 hypothetical protein GLYMA_13G014200 [Glycine max] KRH17834.1 hypothetical protein GLYMA_13G019900 [Glycine max] Length = 184 Score = 62.8 bits (151), Expect = 4e-10 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +3 Query: 126 LMIHDNSSDRTALVLATHHSNFCPINFRW 212 LMIHDNSSDRTA V ATHHSNFCPINFRW Sbjct: 156 LMIHDNSSDRTAFVPATHHSNFCPINFRW 184 >XP_007417431.1 hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] EGF99321.1 hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] Length = 113 Score = 61.2 bits (147), Expect = 4e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 83 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 113 >XP_007411822.1 hypothetical protein MELLADRAFT_88315 [Melampsora larici-populina 98AG31] XP_007417440.1 hypothetical protein MELLADRAFT_94739 [Melampsora larici-populina 98AG31] EGF99314.1 hypothetical protein MELLADRAFT_94739 [Melampsora larici-populina 98AG31] EGG05069.1 hypothetical protein MELLADRAFT_88315 [Melampsora larici-populina 98AG31] Length = 113 Score = 61.2 bits (147), Expect = 4e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 83 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 113 >XP_007405671.1 hypothetical protein MELLADRAFT_92514 [Melampsora larici-populina 98AG31] EGG11069.1 hypothetical protein MELLADRAFT_92514 [Melampsora larici-populina 98AG31] Length = 126 Score = 61.2 bits (147), Expect = 5e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 274 LSGIEP*FSVTRHHHGRPLSYHRKLIGQKFE 182 LSGIEP F VTRHHHGRPLSYHRKLIGQ FE Sbjct: 96 LSGIEPLFPVTRHHHGRPLSYHRKLIGQIFE 126