BLASTX nr result
ID: Glycyrrhiza28_contig00018385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018385 (737 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP34990.1 Aspartic proteinase nepenthesin-2 [Cajanus cajan] 59 1e-06 XP_002520371.1 PREDICTED: aspartic proteinase nepenthesin-1 [Ric... 59 2e-06 XP_007141420.1 hypothetical protein PHAVU_008G193900g [Phaseolus... 59 3e-06 KHN35897.1 Aspartic proteinase nepenthesin-2 [Glycine soja] 58 3e-06 XP_014634873.1 PREDICTED: aspartic proteinase nepenthesin-1-like... 58 3e-06 XP_019455958.1 PREDICTED: aspartyl protease family protein 2-lik... 58 5e-06 BAT88847.1 hypothetical protein VIGAN_05247700 [Vigna angularis ... 57 8e-06 XP_007146226.1 hypothetical protein PHAVU_006G022800g [Phaseolus... 57 8e-06 XP_017436774.1 PREDICTED: aspartyl protease family protein 2 [Vi... 57 8e-06 >KYP34990.1 Aspartic proteinase nepenthesin-2 [Cajanus cajan] Length = 551 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEG 464 DTFYY QIKS+MVGGEVLKI EETWHL AEG Sbjct: 390 DTFYYVQIKSIMVGGEVLKIPEETWHLSAEG 420 >XP_002520371.1 PREDICTED: aspartic proteinase nepenthesin-1 [Ricinus communis] EEF41987.1 basic 7S globulin 2 precursor small subunit, putative [Ricinus communis] Length = 557 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEGA 461 DTFYY QIKS+MVGGEVLKI EETWHL EGA Sbjct: 396 DTFYYVQIKSIMVGGEVLKIPEETWHLSPEGA 427 >XP_007141420.1 hypothetical protein PHAVU_008G193900g [Phaseolus vulgaris] ESW13414.1 hypothetical protein PHAVU_008G193900g [Phaseolus vulgaris] Length = 554 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEGA 461 DTFYY QIKSVMV GEVLKI EETWHL AEGA Sbjct: 394 DTFYYVQIKSVMVDGEVLKIPEETWHLSAEGA 425 >KHN35897.1 Aspartic proteinase nepenthesin-2 [Glycine soja] Length = 530 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEG 464 DTFYY QIKS+MVGGEVLKI EETWHL A+G Sbjct: 369 DTFYYVQIKSIMVGGEVLKIPEETWHLSAQG 399 >XP_014634873.1 PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max] KRH46018.1 hypothetical protein GLYMA_08G307600 [Glycine max] Length = 557 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEG 464 DTFYY QIKS+MVGGEVLKI EETWHL A+G Sbjct: 395 DTFYYVQIKSIMVGGEVLKIPEETWHLSAQG 425 >XP_019455958.1 PREDICTED: aspartyl protease family protein 2-like [Lupinus angustifolius] XP_019455959.1 PREDICTED: aspartyl protease family protein 2-like [Lupinus angustifolius] OIW04204.1 hypothetical protein TanjilG_00764 [Lupinus angustifolius] Length = 556 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEGA 461 DTFYY QIKSVMVGGEVL+I EETWHL EGA Sbjct: 395 DTFYYVQIKSVMVGGEVLEIPEETWHLSEEGA 426 >BAT88847.1 hypothetical protein VIGAN_05247700 [Vigna angularis var. angularis] Length = 487 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEG 464 DTFYY QIKS+MVGGEVLKI E+TWHL A+G Sbjct: 326 DTFYYVQIKSIMVGGEVLKIPEDTWHLSAQG 356 >XP_007146226.1 hypothetical protein PHAVU_006G022800g [Phaseolus vulgaris] ESW18220.1 hypothetical protein PHAVU_006G022800g [Phaseolus vulgaris] Length = 553 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEG 464 DTFYY QIKS+MVGGEVLKI E+TWHL A+G Sbjct: 392 DTFYYVQIKSIMVGGEVLKIPEDTWHLSAQG 422 >XP_017436774.1 PREDICTED: aspartyl protease family protein 2 [Vigna angularis] KOM51831.1 hypothetical protein LR48_Vigan09g049000 [Vigna angularis] Length = 556 Score = 57.0 bits (136), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 556 DTFYYAQIKSVMVGGEVLKIVEETWHL*AEG 464 DTFYY QIKS+MVGGEVLKI E+TWHL A+G Sbjct: 395 DTFYYVQIKSIMVGGEVLKIPEDTWHLSAQG 425