BLASTX nr result
ID: Glycyrrhiza28_contig00018319
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018319 (273 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH03433.1 hypothetical protein GLYMA_17G097500 [Glycine max] 56 4e-07 KRH03435.1 hypothetical protein GLYMA_17G097500 [Glycine max] 56 4e-07 KRH03434.1 hypothetical protein GLYMA_17G097500 [Glycine max] 56 4e-07 XP_014625243.1 PREDICTED: uncharacterized protein LOC100804293 i... 56 4e-07 KRH03436.1 hypothetical protein GLYMA_17G097500 [Glycine max] 56 4e-07 XP_014625242.1 PREDICTED: uncharacterized protein LOC100804293 i... 56 4e-07 KRH03430.1 hypothetical protein GLYMA_17G097500 [Glycine max] 56 4e-07 XP_006600676.1 PREDICTED: uncharacterized protein LOC100804293 i... 56 4e-07 XP_014625241.1 PREDICTED: uncharacterized protein LOC100804293 i... 56 4e-07 XP_014625240.1 PREDICTED: uncharacterized protein LOC100804293 i... 56 4e-07 XP_006579544.1 PREDICTED: uncharacterized protein LOC100775851 i... 54 3e-06 XP_003524936.1 PREDICTED: protein PAF1 homolog isoform X1 [Glyci... 54 3e-06 >KRH03433.1 hypothetical protein GLYMA_17G097500 [Glycine max] Length = 546 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >KRH03435.1 hypothetical protein GLYMA_17G097500 [Glycine max] Length = 547 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >KRH03434.1 hypothetical protein GLYMA_17G097500 [Glycine max] Length = 549 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >XP_014625243.1 PREDICTED: uncharacterized protein LOC100804293 isoform X5 [Glycine max] Length = 550 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >KRH03436.1 hypothetical protein GLYMA_17G097500 [Glycine max] Length = 551 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >XP_014625242.1 PREDICTED: uncharacterized protein LOC100804293 isoform X4 [Glycine max] Length = 552 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >KRH03430.1 hypothetical protein GLYMA_17G097500 [Glycine max] Length = 630 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >XP_006600676.1 PREDICTED: uncharacterized protein LOC100804293 isoform X3 [Glycine max] KRH03432.1 hypothetical protein GLYMA_17G097500 [Glycine max] Length = 631 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >XP_014625241.1 PREDICTED: uncharacterized protein LOC100804293 isoform X2 [Glycine max] KRH03431.1 hypothetical protein GLYMA_17G097500 [Glycine max] Length = 633 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >XP_014625240.1 PREDICTED: uncharacterized protein LOC100804293 isoform X1 [Glycine max] Length = 634 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 125 HQHPSNTTTYDGDRSFKRPRIDDDPFNFSDDERRLKLIRDH 3 + HP Y +FKRPRIDD+P NFSDDERRLKLIRDH Sbjct: 31 YYHPHPPFPY---ANFKRPRIDDNPINFSDDERRLKLIRDH 68 >XP_006579544.1 PREDICTED: uncharacterized protein LOC100775851 isoform X2 [Glycine max] Length = 621 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -2 Query: 83 SFKRPRIDDDPFNFSDDERRLKLIRDH 3 +FKRPRIDD+P +FSDDERRLKLIRDH Sbjct: 40 NFKRPRIDDNPISFSDDERRLKLIRDH 66 >XP_003524936.1 PREDICTED: protein PAF1 homolog isoform X1 [Glycine max] KRH56953.1 hypothetical protein GLYMA_05G029400 [Glycine max] Length = 624 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -2 Query: 83 SFKRPRIDDDPFNFSDDERRLKLIRDH 3 +FKRPRIDD+P +FSDDERRLKLIRDH Sbjct: 40 NFKRPRIDDNPISFSDDERRLKLIRDH 66