BLASTX nr result
ID: Glycyrrhiza28_contig00018261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018261 (320 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_029878978.1 MULTISPECIES: DUF805 domain-containing protein [B... 96 3e-23 SFL32988.1 Uncharacterized membrane protein YhaH, DUF805 family ... 55 4e-07 SEI17584.1 Uncharacterized membrane protein YhaH, DUF805 family ... 55 4e-07 WP_068732787.1 DUF805 domain-containing protein [Tardiphaga sp. ... 55 4e-07 WP_011471289.1 DUF805 domain-containing protein [Rhodopseudomona... 54 7e-07 WP_011156193.1 DUF805 domain-containing protein [Rhodopseudomona... 53 3e-06 SHL45188.1 Uncharacterized membrane protein YhaH, DUF805 family ... 52 4e-06 WP_020173939.1 DUF805 domain-containing protein [Methyloferula s... 52 5e-06 >WP_029878978.1 MULTISPECIES: DUF805 domain-containing protein [Bradyrhizobium] KIU44976.1 hypothetical protein QU41_27600 [Bradyrhizobium elkanii] OCX26781.1 hypothetical protein QU42_34720 [Bradyrhizobium sp. UASWS1016] Length = 135 Score = 95.9 bits (237), Expect = 3e-23 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -3 Query: 318 FLGPVILGAVAMLGDAIARVCEISALAISIWMIVELGCRPGTAGPNRYGPDPL 160 FLGPVIL A+AMLG AIA VC+++ALA+S+W IVELGCRPGT GPNRYGPDPL Sbjct: 83 FLGPVILAAIAMLGGAIASVCDLAALAVSVWTIVELGCRPGTTGPNRYGPDPL 135 >SFL32988.1 Uncharacterized membrane protein YhaH, DUF805 family [Bradyrhizobium sp. NFR13] Length = 158 Score = 55.1 bits (131), Expect = 4e-07 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -3 Query: 318 FLGPVILGAVAMLGDAIAR-VCEISALAISIWMIVELGCRPGTAGPNRYGPDPL 160 +LGP +L + A V I++ A++IW IVELG GTAGPN YGPDPL Sbjct: 96 WLGPSVLSGIGSTSSASTSFVFHIASFAVTIWAIVELGFLRGTAGPNEYGPDPL 149 >SEI17584.1 Uncharacterized membrane protein YhaH, DUF805 family [Tardiphaga sp. OK245] Length = 158 Score = 55.1 bits (131), Expect = 4e-07 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -3 Query: 318 FLGPVILGAVAMLGDAIAR-VCEISALAISIWMIVELGCRPGTAGPNRYGPDPL 160 +LGP +L + A V I++ A++IW IVELG GTAGPN YGPDPL Sbjct: 96 WLGPSVLSGIGSTSSASTSFVFHIASFAVTIWAIVELGFLRGTAGPNEYGPDPL 149 >WP_068732787.1 DUF805 domain-containing protein [Tardiphaga sp. Vaf07] KZD22912.1 hypothetical protein A4A58_05750 [Tardiphaga sp. Vaf07] Length = 158 Score = 55.1 bits (131), Expect = 4e-07 Identities = 27/54 (50%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = -3 Query: 318 FLGPVILGAVAMLGDAIAR-VCEISALAISIWMIVELGCRPGTAGPNRYGPDPL 160 +LGP +L + A V I++ A++IW IVELG GTAGPN YGPDPL Sbjct: 96 WLGPSVLSGIGSTSSASTSFVFHIASFAVTIWAIVELGFLRGTAGPNEYGPDPL 149 >WP_011471289.1 DUF805 domain-containing protein [Rhodopseudomonas palustris] ABD86381.1 protein of unknown function DUF805 [Rhodopseudomonas palustris BisB18] Length = 155 Score = 54.3 bits (129), Expect = 7e-07 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = -3 Query: 318 FLGPVILGAVA--MLGDAIARVCEISALAISIWMIVELGCRPGTAGPNRYGPDPL 160 +LGP +LG + +L + V + + AISIW VELGC GT GPN YGPDPL Sbjct: 96 WLGPSLLGGGSRTVLHGGSSLVSSLLSAAISIWAFVELGCLRGTPGPNLYGPDPL 150 >WP_011156193.1 DUF805 domain-containing protein [Rhodopseudomonas palustris] CAE26069.1 conserved hypothetical protein [Rhodopseudomonas palustris CGA009] ACE99188.1 protein of unknown function DUF805 [Rhodopseudomonas palustris TIE-1] Length = 157 Score = 52.8 bits (125), Expect = 3e-06 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = -3 Query: 318 FLGPVILGAV--AMLGDAIARVCEISALAISIWMIVELGCRPGTAGPNRYGPDPL 160 + GP +LG M ++ V + L I+IW VELGC GT GPN+YGPDPL Sbjct: 96 WFGPSLLGGSNQTMEDSPVSLVLALIGLGIAIWGFVELGCLRGTPGPNQYGPDPL 150 >SHL45188.1 Uncharacterized membrane protein YhaH, DUF805 family [Bradyrhizobium lablabi] Length = 154 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 7/60 (11%) Frame = -3 Query: 318 FLGPVILGAVA-------MLGDAIARVCEISALAISIWMIVELGCRPGTAGPNRYGPDPL 160 +L P LG +A + G A+ + ++A A+++W VE+GC GTAG N YGPDPL Sbjct: 86 YLMPAALGRLAEAAWLAGIAGTALHSILALAAFALTVWGFVEIGCLRGTAGSNTYGPDPL 145 >WP_020173939.1 DUF805 domain-containing protein [Methyloferula stellata] Length = 138 Score = 51.6 bits (122), Expect = 5e-06 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = -3 Query: 309 PVILGAVAMLGD-AIARVCEISALAISIWMIVELGCRPGTAGPNRYGPDPL 160 P++ G +A D + + +++ AI+IW +ELGC GT GPNR+GPDPL Sbjct: 86 PLLFGYIADTTDIGVEFLLSLASTAIAIWGFIELGCLRGTEGPNRFGPDPL 136