BLASTX nr result
ID: Glycyrrhiza28_contig00018194
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018194 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABO80462.1 U2 auxiliary factor small subunit [Medicago truncatula] 67 7e-11 XP_012575300.1 PREDICTED: uncharacterized protein LOC101495256 [... 67 9e-11 XP_003592893.2 zinc finger CCCH domain protein, putative [Medica... 67 2e-10 GAU20140.1 hypothetical protein TSUD_352020 [Trifolium subterran... 61 7e-09 >ABO80462.1 U2 auxiliary factor small subunit [Medicago truncatula] Length = 251 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 125 LNDPEEQRKRLLLEQQEADRILRDRIAFEESERAWILR 238 LNDPEE+RKR+LLEQQEA+RI RDRIAFEE E+AWI++ Sbjct: 36 LNDPEEERKRILLEQQEAERIERDRIAFEEREKAWIIK 73 >XP_012575300.1 PREDICTED: uncharacterized protein LOC101495256 [Cicer arietinum] Length = 1435 Score = 67.4 bits (163), Expect = 9e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +2 Query: 125 LNDPEEQRKRLLLEQQEADRILRDRIAFEESERAWILR 238 LNDPEEQRK LLLEQQEA+R+ RDRIAFEESERAW+++ Sbjct: 47 LNDPEEQRKMLLLEQQEAERMQRDRIAFEESERAWMIK 84 >XP_003592893.2 zinc finger CCCH domain protein, putative [Medicago truncatula] AES63144.2 zinc finger CCCH domain protein, putative [Medicago truncatula] Length = 827 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = +2 Query: 125 LNDPEEQRKRLLLEQQEADRILRDRIAFEESERAWILR 238 LNDPEE+RKR+LLEQQEA+RI RDRIAFEE E+AWI++ Sbjct: 36 LNDPEEERKRILLEQQEAERIERDRIAFEEREKAWIIK 73 >GAU20140.1 hypothetical protein TSUD_352020 [Trifolium subterraneum] Length = 214 Score = 60.8 bits (146), Expect = 7e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 125 LNDPEEQRKRLLLEQQEADRILRDRIAFEESERAWILR 238 LNDPEEQRK LLLEQ+EA+RI RDRIAF+E E WI++ Sbjct: 48 LNDPEEQRKMLLLEQEEAERIERDRIAFQERENDWIIK 85