BLASTX nr result
ID: Glycyrrhiza28_contig00018134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018134 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 85 5e-17 XP_003598334.1 F-box protein interaction domain protein [Medicag... 85 7e-17 GAU20081.1 hypothetical protein TSUD_381730 [Trifolium subterran... 82 3e-16 XP_003601620.1 F-box protein interaction domain protein [Medicag... 82 5e-16 XP_013459397.1 F-box protein interaction domain protein [Medicag... 81 2e-15 GAU20084.1 hypothetical protein TSUD_381760 [Trifolium subterran... 81 2e-15 GAU20082.1 hypothetical protein TSUD_381740 [Trifolium subterran... 80 3e-15 AFK34264.1 unknown [Medicago truncatula] 80 3e-15 GAU20086.1 hypothetical protein TSUD_381780 [Trifolium subterran... 80 4e-15 XP_013464670.1 F-box protein interaction domain protein [Medicag... 79 5e-15 XP_013452619.1 F-box protein interaction domain protein [Medicag... 79 5e-15 XP_013441569.1 F-box protein interaction domain protein [Medicag... 79 6e-15 XP_003598348.1 F-box protein interaction domain protein [Medicag... 79 8e-15 XP_003598343.1 F-box protein interaction domain protein [Medicag... 79 9e-15 XP_003599218.1 F-box protein interaction domain protein [Medicag... 79 1e-14 GAU24893.1 hypothetical protein TSUD_116170 [Trifolium subterran... 79 1e-14 GAU50212.1 hypothetical protein TSUD_408950 [Trifolium subterran... 79 1e-14 XP_003594508.2 F-box protein interaction domain protein [Medicag... 78 2e-14 XP_013458778.1 F-box protein interaction domain protein [Medicag... 78 2e-14 GAU20090.1 hypothetical protein TSUD_381820 [Trifolium subterran... 78 2e-14 >XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 405 Score = 85.1 bits (209), Expect = 5e-17 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 FE++ EIL RLPVK L + RCVCKS+ SLI DPKF KKHLRVST RHHL ++ NSSR Sbjct: 50 FELVAEILSRLPVKILMQLRCVCKSWKSLICDPKFVKKHLRVSTT--RHHLFLTFLNSSR 107 Query: 13 KFLL 2 +F+L Sbjct: 108 EFVL 111 >XP_003598334.1 F-box protein interaction domain protein [Medicago truncatula] AES68585.1 F-box protein interaction domain protein [Medicago truncatula] Length = 417 Score = 84.7 bits (208), Expect = 7e-17 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 F+++ EIL RLPVK L + RC+CKSFNSLISDPKFAKKHL++STA RHHL++ STN+ Sbjct: 38 FDLVAEILCRLPVKLLVQLRCLCKSFNSLISDPKFAKKHLQMSTA--RHHLMLRSTNNLG 95 Query: 13 KFLL 2 K L Sbjct: 96 KLFL 99 >GAU20081.1 hypothetical protein TSUD_381730 [Trifolium subterraneum] Length = 300 Score = 82.0 bits (201), Expect = 3e-16 Identities = 41/64 (64%), Positives = 49/64 (76%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 FE++VEIL RLP+KSL +F+CVCKS+ SLISDPKFAKKHLRVST HH I + NS Sbjct: 70 FELIVEILSRLPMKSLMQFQCVCKSWKSLISDPKFAKKHLRVST--KHHHFITTFPNSVM 127 Query: 13 KFLL 2 + L Sbjct: 128 SYPL 131 >XP_003601620.1 F-box protein interaction domain protein [Medicago truncatula] AES71871.1 F-box protein interaction domain protein [Medicago truncatula] Length = 405 Score = 82.4 bits (202), Expect = 5e-16 Identities = 42/64 (65%), Positives = 48/64 (75%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 FE++ EIL RLPVK L + RC+CKSFNSLISDPKFAKKHL ST HHLI+ S N S Sbjct: 57 FELVAEILCRLPVKLLLQLRCLCKSFNSLISDPKFAKKHLHSSTT--PHHLILRSNNGSG 114 Query: 13 KFLL 2 +F L Sbjct: 115 RFAL 118 >XP_013459397.1 F-box protein interaction domain protein [Medicago truncatula] KEH33428.1 F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 80.9 bits (198), Expect = 2e-15 Identities = 42/64 (65%), Positives = 49/64 (76%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 F++L EIL RLPVK L + RC+CK FNSLISDP+FAKKHL +ST RHHLIVSS N Sbjct: 43 FDLLPEILCRLPVKLLVQLRCLCKFFNSLISDPEFAKKHLHLSTM--RHHLIVSSKNDKS 100 Query: 13 KFLL 2 + LL Sbjct: 101 RELL 104 >GAU20084.1 hypothetical protein TSUD_381760 [Trifolium subterraneum] Length = 421 Score = 80.9 bits (198), Expect = 2e-15 Identities = 40/64 (62%), Positives = 50/64 (78%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 FE++ EIL +LPVKSL +F+CVCKS+ SLISDPKFAKKHLR+ST HHLI + NS+ Sbjct: 62 FELIAEILSKLPVKSLMQFQCVCKSWKSLISDPKFAKKHLRMST--KHHHLISTFANSAL 119 Query: 13 KFLL 2 + L Sbjct: 120 DYPL 123 >GAU20082.1 hypothetical protein TSUD_381740 [Trifolium subterraneum] Length = 391 Score = 80.1 bits (196), Expect = 3e-15 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 FE++VEIL +LP+KSL +F+CVCKS+ SLISDPKFAKKHLRVST HH I + NS Sbjct: 47 FELIVEILSKLPMKSLMQFQCVCKSWKSLISDPKFAKKHLRVST--KHHHFISTFPNSVM 104 Query: 13 KFLL 2 + L Sbjct: 105 SYPL 108 >AFK34264.1 unknown [Medicago truncatula] Length = 405 Score = 80.1 bits (196), Expect = 3e-15 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = -1 Query: 190 EILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSRK 11 E++ EIL RLPVK L + RC+CKSFNSLISDPKFAKKHL ST HHLI+ S N S + Sbjct: 58 ELVAEILCRLPVKLLLQLRCLCKSFNSLISDPKFAKKHLHSSTT--PHHLILRSNNGSGR 115 Query: 10 FLL 2 F L Sbjct: 116 FAL 118 >GAU20086.1 hypothetical protein TSUD_381780 [Trifolium subterraneum] Length = 406 Score = 79.7 bits (195), Expect = 4e-15 Identities = 40/64 (62%), Positives = 50/64 (78%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 FEI+ EIL +LPVK L + + VCK + SLISDPKFAKKHLRVST RHHLI++ N SR Sbjct: 50 FEIIAEILSKLPVKFLMQLQFVCKPWKSLISDPKFAKKHLRVSTT--RHHLILTYINPSR 107 Query: 13 KFLL 2 +F++ Sbjct: 108 EFVM 111 >XP_013464670.1 F-box protein interaction domain protein [Medicago truncatula] KEH38705.1 F-box protein interaction domain protein [Medicago truncatula] Length = 358 Score = 79.3 bits (194), Expect = 5e-15 Identities = 39/64 (60%), Positives = 49/64 (76%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 F+++ EIL RLPVK L + RC+CKS NSLISDPKFAKKHLR+S RHHL++SS N Sbjct: 35 FDLVAEILCRLPVKLLIQLRCLCKSINSLISDPKFAKKHLRMSNT--RHHLMLSSNNDLD 92 Query: 13 KFLL 2 + +L Sbjct: 93 ELVL 96 >XP_013452619.1 F-box protein interaction domain protein [Medicago truncatula] KEH26647.1 F-box protein interaction domain protein [Medicago truncatula] Length = 361 Score = 79.3 bits (194), Expect = 5e-15 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTN 23 F+++ EIL RLPVK L + RC+CKSFNSLISDPKFA KHLR+ST RHR L++ STN Sbjct: 18 FDLVAEILCRLPVKLLLQLRCLCKSFNSLISDPKFANKHLRLSTRRHR--LMLMSTN 72 >XP_013441569.1 F-box protein interaction domain protein [Medicago truncatula] KEH15594.1 F-box protein interaction domain protein [Medicago truncatula] Length = 392 Score = 79.3 bits (194), Expect = 6e-15 Identities = 40/63 (63%), Positives = 50/63 (79%) Frame = -1 Query: 190 EILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSRK 11 +++ EIL RLPVK L +FRCVCKSF SLISD KF KKHL++ST RHHL+VS+TN+ + Sbjct: 50 DLVAEILCRLPVKLLLQFRCVCKSFKSLISDHKFGKKHLQLST--KRHHLLVSTTNNLGE 107 Query: 10 FLL 2 LL Sbjct: 108 LLL 110 >XP_003598348.1 F-box protein interaction domain protein [Medicago truncatula] AES68599.1 F-box protein interaction domain protein [Medicago truncatula] Length = 386 Score = 79.0 bits (193), Expect = 8e-15 Identities = 39/58 (67%), Positives = 48/58 (82%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNS 20 F++L EIL RLPVK L + RC+CK FNSLISDPKFAKKHL++ST RHHL+V+S N+ Sbjct: 41 FDVLPEILCRLPVKLLVQLRCLCKFFNSLISDPKFAKKHLQLST--KRHHLMVTSKNN 96 >XP_003598343.1 F-box protein interaction domain protein [Medicago truncatula] AES68594.1 F-box protein interaction domain protein [Medicago truncatula] Length = 360 Score = 78.6 bits (192), Expect = 9e-15 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 F++L EIL RLPVK L + RC+CK FNSLISDPKFAKKHL++ST RHHL+ N SR Sbjct: 27 FDVLPEILFRLPVKLLVQLRCLCKFFNSLISDPKFAKKHLQLST--KRHHLMRKCRNISR 84 Query: 13 KFLL 2 + +L Sbjct: 85 ELVL 88 >XP_003599218.1 F-box protein interaction domain protein [Medicago truncatula] AES69469.1 F-box protein interaction domain protein [Medicago truncatula] Length = 372 Score = 78.6 bits (192), Expect = 1e-14 Identities = 38/64 (59%), Positives = 50/64 (78%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 F+++ EIL RLPVK LF+ RCVCK F+SLISDPKFAK HL++ST RHHL+++S N+ Sbjct: 22 FDLIAEILCRLPVKFLFQLRCVCKFFHSLISDPKFAKNHLQLST--KRHHLMIASMNNLA 79 Query: 13 KFLL 2 +L Sbjct: 80 DLVL 83 >GAU24893.1 hypothetical protein TSUD_116170 [Trifolium subterraneum] Length = 383 Score = 78.6 bits (192), Expect = 1e-14 Identities = 41/63 (65%), Positives = 51/63 (80%) Frame = -1 Query: 190 EILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSRK 11 +++ EIL RLPVK L +FRC+ KSF SLISD KFAKKHLR+ST RHHL+VSSTN+S + Sbjct: 42 DLIEEILCRLPVKLLLQFRCLNKSFKSLISDSKFAKKHLRLST--KRHHLMVSSTNNSDE 99 Query: 10 FLL 2 +L Sbjct: 100 LVL 102 >GAU50212.1 hypothetical protein TSUD_408950 [Trifolium subterraneum] Length = 402 Score = 78.6 bits (192), Expect = 1e-14 Identities = 42/64 (65%), Positives = 49/64 (76%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 F+++ EIL RLPVK L + R +CKS N LISDPKFAKKHLR+S RHHLI SSTN SR Sbjct: 49 FDLVSEILCRLPVKLLSQLRYLCKSINCLISDPKFAKKHLRLSI--KRHHLIGSSTNDSR 106 Query: 13 KFLL 2 + LL Sbjct: 107 ELLL 110 >XP_003594508.2 F-box protein interaction domain protein [Medicago truncatula] AES64759.2 F-box protein interaction domain protein [Medicago truncatula] Length = 405 Score = 78.2 bits (191), Expect = 2e-14 Identities = 41/64 (64%), Positives = 48/64 (75%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 FEI+ EIL RLPVK L + + VCKS+ SLISDPKF KKHL VST R HL+++ NSSR Sbjct: 53 FEIVAEILSRLPVKYLMQLQSVCKSWKSLISDPKFIKKHLHVSTT--RLHLVLAFANSSR 110 Query: 13 KFLL 2 KF L Sbjct: 111 KFAL 114 >XP_013458778.1 F-box protein interaction domain protein [Medicago truncatula] KEH32810.1 F-box protein interaction domain protein [Medicago truncatula] Length = 381 Score = 77.8 bits (190), Expect = 2e-14 Identities = 39/64 (60%), Positives = 51/64 (79%) Frame = -1 Query: 193 FEILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSR 14 F+++ EIL RLPVK L + RC+CKSFN+LISDPKFAKKHL++ST R+R L++ STN+ Sbjct: 23 FDLVAEILCRLPVKLLVQLRCLCKSFNTLISDPKFAKKHLQMSTKRNR--LMLRSTNNLG 80 Query: 13 KFLL 2 K L Sbjct: 81 KLFL 84 >GAU20090.1 hypothetical protein TSUD_381820 [Trifolium subterraneum] Length = 439 Score = 77.8 bits (190), Expect = 2e-14 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = -1 Query: 190 EILVEILQRLPVKSLFRFRCVCKSFNSLISDPKFAKKHLRVSTARHRHHLIVSSTNSSRK 11 EI+ EIL RLP+K L + + VCK + SLISDPKFAKKH R+ST RHHL+++ TN SR+ Sbjct: 67 EIIAEILSRLPIKFLIQLQSVCKPWKSLISDPKFAKKHFRLSTT--RHHLVLTHTNPSRE 124 Query: 10 FLL 2 ++L Sbjct: 125 YVL 127