BLASTX nr result
ID: Glycyrrhiza28_contig00018098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00018098 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003612430.1 auxin efflux carrier family protein [Medicago tru... 57 2e-08 OIW09609.1 hypothetical protein TanjilG_28208 [Lupinus angustifo... 59 3e-08 XP_019446919.1 PREDICTED: protein PIN-LIKES 3-like isoform X2 [L... 59 3e-08 XP_019446918.1 PREDICTED: protein PIN-LIKES 3-like isoform X1 [L... 59 3e-08 XP_004512295.1 PREDICTED: uncharacterized transporter C5D6.04-li... 59 4e-08 KYP39161.1 putative transporter C5D6.04, partial [Cajanus cajan] 59 4e-08 GAU28084.1 hypothetical protein TSUD_223250 [Trifolium subterran... 58 5e-08 XP_017431984.1 PREDICTED: protein PIN-LIKES 3-like [Vigna angula... 58 5e-08 XP_003612434.1 auxin efflux carrier family protein [Medicago tru... 57 1e-07 XP_019074869.1 PREDICTED: protein PIN-LIKES 3-like [Vitis vinifera] 57 1e-07 KYP39163.1 putative transporter C5D6.04 [Cajanus cajan] 57 1e-07 XP_007156270.1 hypothetical protein PHAVU_003G272300g [Phaseolus... 57 1e-07 XP_014617772.1 PREDICTED: uncharacterized transporter C5D6.04-li... 57 1e-07 XP_017426168.1 PREDICTED: protein PIN-LIKES 3-like [Vigna angula... 57 1e-07 XP_003517114.1 PREDICTED: uncharacterized transporter YBR287W [G... 57 1e-07 KHN28298.1 Putative transporter C5D6.04 [Glycine soja] 57 1e-07 ACJ85428.1 unknown [Medicago truncatula] AFK36849.1 unknown [Med... 57 1e-07 XP_003612431.1 auxin efflux carrier family protein [Medicago tru... 57 1e-07 XP_013453603.1 auxin efflux carrier family protein [Medicago tru... 57 1e-07 CBI37490.3 unnamed protein product, partial [Vitis vinifera] 57 1e-07 >XP_003612430.1 auxin efflux carrier family protein [Medicago truncatula] AES95388.1 auxin efflux carrier family protein [Medicago truncatula] Length = 154 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSV+MLWTYALAS+A Sbjct: 114 GTIAQLFGAGESECSVMMLWTYALASIA 141 >OIW09609.1 hypothetical protein TanjilG_28208 [Lupinus angustifolius] Length = 380 Score = 58.9 bits (141), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSVIMLWTYALASVA Sbjct: 340 GTIAQLFGAGESECSVIMLWTYALASVA 367 >XP_019446919.1 PREDICTED: protein PIN-LIKES 3-like isoform X2 [Lupinus angustifolius] Length = 400 Score = 58.9 bits (141), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSVIMLWTYALASVA Sbjct: 360 GTIAQLFGAGESECSVIMLWTYALASVA 387 >XP_019446918.1 PREDICTED: protein PIN-LIKES 3-like isoform X1 [Lupinus angustifolius] Length = 411 Score = 58.9 bits (141), Expect = 3e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSVIMLWTYALASVA Sbjct: 371 GTIAQLFGAGESECSVIMLWTYALASVA 398 >XP_004512295.1 PREDICTED: uncharacterized transporter C5D6.04-like [Cicer arietinum] Length = 344 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSVIMLWTYALAS+A Sbjct: 304 GTIAQLFGAGESECSVIMLWTYALASIA 331 >KYP39161.1 putative transporter C5D6.04, partial [Cajanus cajan] Length = 417 Score = 58.5 bits (140), Expect = 4e-08 Identities = 38/66 (57%), Positives = 41/66 (62%), Gaps = 4/66 (6%) Frame = +1 Query: 70 IVLTVIHLSKTLISGSRYNELY-ITQLFQLYFPMS---GTIAQLFGAGESECSVIMLWTY 237 +V IHLS R + LY L Q P + GTIAQLFGAGESECSVIMLWTY Sbjct: 344 VVKGAIHLSLV-----RSDALYQFVLLLQYALPPAMNIGTIAQLFGAGESECSVIMLWTY 398 Query: 238 ALASVA 255 A ASVA Sbjct: 399 AFASVA 404 >GAU28084.1 hypothetical protein TSUD_223250 [Trifolium subterraneum] Length = 401 Score = 58.2 bits (139), Expect = 5e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECS+IMLWTYALAS+A Sbjct: 361 GTIAQLFGAGESECSIIMLWTYALASIA 388 >XP_017431984.1 PREDICTED: protein PIN-LIKES 3-like [Vigna angularis] KOM32108.1 hypothetical protein LR48_Vigan01g166400 [Vigna angularis] BAT75270.1 hypothetical protein VIGAN_01310400 [Vigna angularis var. angularis] Length = 412 Score = 58.2 bits (139), Expect = 5e-08 Identities = 34/62 (54%), Positives = 40/62 (64%) Frame = +1 Query: 70 IVLTVIHLSKTLISGSRYNELYITQLFQLYFPMSGTIAQLFGAGESECSVIMLWTYALAS 249 +V IHLS + S S Y + + Q GTIAQLFG+GESECSVIMLWTY LAS Sbjct: 339 VVKAAIHLS-LVHSDSLYQFVLLLQYALPPAMNIGTIAQLFGSGESECSVIMLWTYGLAS 397 Query: 250 VA 255 +A Sbjct: 398 IA 399 >XP_003612434.1 auxin efflux carrier family protein [Medicago truncatula] AES95392.1 auxin efflux carrier family protein [Medicago truncatula] Length = 353 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSV+MLWTYALAS+A Sbjct: 313 GTIAQLFGAGESECSVMMLWTYALASIA 340 >XP_019074869.1 PREDICTED: protein PIN-LIKES 3-like [Vitis vinifera] Length = 401 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTI QLFGAGESECSVIMLWTYALASVA Sbjct: 361 GTITQLFGAGESECSVIMLWTYALASVA 388 >KYP39163.1 putative transporter C5D6.04 [Cajanus cajan] Length = 414 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFG+GESECSVIMLWTYALAS+A Sbjct: 374 GTIAQLFGSGESECSVIMLWTYALASIA 401 >XP_007156270.1 hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris] ESW28264.1 hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris] Length = 414 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSVIMLWTYALA++A Sbjct: 374 GTIAQLFGAGESECSVIMLWTYALAAIA 401 >XP_014617772.1 PREDICTED: uncharacterized transporter C5D6.04-like [Glycine max] KRH39385.1 hypothetical protein GLYMA_09G195600 [Glycine max] KRH39386.1 hypothetical protein GLYMA_09G195600 [Glycine max] Length = 414 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFG+GESECSVIMLWTYALAS+A Sbjct: 374 GTIAQLFGSGESECSVIMLWTYALASIA 401 >XP_017426168.1 PREDICTED: protein PIN-LIKES 3-like [Vigna angularis] XP_017426169.1 PREDICTED: protein PIN-LIKES 3-like [Vigna angularis] KOM45329.1 hypothetical protein LR48_Vigan06g063500 [Vigna angularis] BAT99844.1 hypothetical protein VIGAN_10137300 [Vigna angularis var. angularis] Length = 415 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGE ECSVIMLWTYALASVA Sbjct: 375 GTIAQLFGAGEGECSVIMLWTYALASVA 402 >XP_003517114.1 PREDICTED: uncharacterized transporter YBR287W [Glycine max] XP_006573505.1 PREDICTED: uncharacterized transporter YBR287W [Glycine max] XP_006573506.1 PREDICTED: uncharacterized transporter YBR287W [Glycine max] XP_014630979.1 PREDICTED: uncharacterized transporter YBR287W [Glycine max] KRH76489.1 hypothetical protein GLYMA_01G156200 [Glycine max] KRH76490.1 hypothetical protein GLYMA_01G156200 [Glycine max] KRH76491.1 hypothetical protein GLYMA_01G156200 [Glycine max] KRH76492.1 hypothetical protein GLYMA_01G156200 [Glycine max] Length = 415 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGE ECSVIMLWTYALASVA Sbjct: 375 GTIAQLFGAGEGECSVIMLWTYALASVA 402 >KHN28298.1 Putative transporter C5D6.04 [Glycine soja] Length = 416 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGE ECSVIMLWTYALASVA Sbjct: 376 GTIAQLFGAGEGECSVIMLWTYALASVA 403 >ACJ85428.1 unknown [Medicago truncatula] AFK36849.1 unknown [Medicago truncatula] AFK46985.1 unknown [Medicago truncatula] Length = 417 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSV+MLWTYALAS+A Sbjct: 377 GTIAQLFGAGESECSVMMLWTYALASIA 404 >XP_003612431.1 auxin efflux carrier family protein [Medicago truncatula] AES95389.1 auxin efflux carrier family protein [Medicago truncatula] Length = 417 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSV+MLWTYALAS+A Sbjct: 377 GTIAQLFGAGESECSVMMLWTYALASIA 404 >XP_013453603.1 auxin efflux carrier family protein [Medicago truncatula] KEH27639.1 auxin efflux carrier family protein [Medicago truncatula] Length = 444 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTIAQLFGAGESECSV+MLWTYALAS+A Sbjct: 404 GTIAQLFGAGESECSVMMLWTYALASIA 431 >CBI37490.3 unnamed protein product, partial [Vitis vinifera] Length = 459 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +1 Query: 172 GTIAQLFGAGESECSVIMLWTYALASVA 255 GTI QLFGAGESECSVIMLWTYALASVA Sbjct: 419 GTITQLFGAGESECSVIMLWTYALASVA 446