BLASTX nr result
ID: Glycyrrhiza28_contig00017978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00017978 (518 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48346.1 hypothetical protein TSUD_267710 [Trifolium subterran... 62 3e-08 XP_012572879.1 PREDICTED: splicing factor U2af large subunit A-l... 61 7e-08 KHN47080.1 Splicing factor U2af large subunit B [Glycine soja] 59 5e-07 >GAU48346.1 hypothetical protein TSUD_267710 [Trifolium subterraneum] Length = 585 Score = 62.4 bits (150), Expect = 3e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -3 Query: 114 MLGY*PHCADNGREPTSVAFISTEESMHLFLVRSLVQI 1 MLGY PHCADNGREPTSVAF+S EESMH FLV + QI Sbjct: 206 MLGYLPHCADNGREPTSVAFMSKEESMHRFLVGLVRQI 243 >XP_012572879.1 PREDICTED: splicing factor U2af large subunit A-like isoform X5 [Cicer arietinum] Length = 636 Score = 61.2 bits (147), Expect = 7e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 117 AMLGY*PHCADNGREPTSVAFISTEESMHLFLV 19 AMLGY PHCADNGREPTSVAF+S EES+H FLV Sbjct: 209 AMLGYLPHCADNGREPTSVAFMSKEESVHRFLV 241 >KHN47080.1 Splicing factor U2af large subunit B [Glycine soja] Length = 653 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 99 PHCADNGREPTSVAFISTEESMHLFLV 19 PHCADNGREPTSVAF+STEESMHLFLV Sbjct: 230 PHCADNGREPTSVAFMSTEESMHLFLV 256