BLASTX nr result
ID: Glycyrrhiza28_contig00017692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00017692 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19216.1 hypothetical protein TSUD_198980 [Trifolium subterran... 59 6e-09 OIV89536.1 hypothetical protein TanjilG_19949 [Lupinus angustifo... 59 9e-08 YP_009306122.1 ATP synthase subunit 6 (mitochondrion) [Corchorus... 55 1e-06 XP_010090950.1 hypothetical protein L484_007585 [Morus notabilis... 53 3e-06 >GAU19216.1 hypothetical protein TSUD_198980 [Trifolium subterraneum] Length = 106 Score = 58.9 bits (141), Expect = 6e-09 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +3 Query: 210 EHYVSRSENICGDI--ETLRGWVEEIKENPNPLKSLIREHL 326 E+ +SR I +I ETLRGWVEEIKENPNPLKSLIREHL Sbjct: 10 ENIMSRDLKISAEIYIETLRGWVEEIKENPNPLKSLIREHL 50 >OIV89536.1 hypothetical protein TanjilG_19949 [Lupinus angustifolius] Length = 416 Score = 58.9 bits (141), Expect = 9e-08 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +3 Query: 210 EHYVSRSENICGDI--ETLRGWVEEIKENPNPLKSLIREHL 326 E+ +SR+ I +I ETLRGWVEEIKENPNPLKSLIREHL Sbjct: 222 ENILSRNLEIYAEIDTETLRGWVEEIKENPNPLKSLIREHL 262 >YP_009306122.1 ATP synthase subunit 6 (mitochondrion) [Corchorus olitorius] AOO95959.1 ATP synthase subunit 6 (mitochondrion) [Corchorus olitorius] Length = 295 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +3 Query: 147 RGRAAFRSLSGNGRNLFQCRREHYVSRSENICGD 248 RG A SLSGNGR QCRR+HYVSRS NICGD Sbjct: 260 RGMGAVHSLSGNGRKRLQCRRKHYVSRSGNICGD 293 >XP_010090950.1 hypothetical protein L484_007585 [Morus notabilis] EXB41435.1 hypothetical protein L484_007585 [Morus notabilis] Length = 176 Score = 53.1 bits (126), Expect = 3e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 2/40 (5%) Frame = +3 Query: 210 EHYVSRSENICG--DIETLRGWVEEIKENPNPLKSLIREH 323 E+ +SR I D ETLRGWVEEIKENPN LKSLIREH Sbjct: 10 ENIMSRDLEISAEMDTETLRGWVEEIKENPNLLKSLIREH 49