BLASTX nr result
ID: Glycyrrhiza28_contig00017379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00017379 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003538051.1 PREDICTED: protein transport protein Sec61 subuni... 52 4e-06 >XP_003538051.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] XP_006591027.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] XP_014620036.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] KRH24907.1 hypothetical protein GLYMA_12G070500 [Glycine max] Length = 107 Score = 52.0 bits (123), Expect = 4e-06 Identities = 30/63 (47%), Positives = 31/63 (49%) Frame = -2 Query: 191 HATTRPGVVAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNMLRFYTDDAPGLKIS 12 HATTRPGV+AP SNMLRFYTDDAPGLKIS Sbjct: 14 HATTRPGVMAPRGTAAATAGMRRRRLGGGTSSASVSGGSGAGGSNMLRFYTDDAPGLKIS 73 Query: 11 PTV 3 PTV Sbjct: 74 PTV 76