BLASTX nr result
ID: Glycyrrhiza28_contig00017153
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00017153 (179 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003607323.2 isochorismate synthase [Medicago truncatula] AES8... 107 5e-26 XP_016198524.1 PREDICTED: isochorismate synthase 2, chloroplasti... 106 1e-25 XP_015960828.1 PREDICTED: isochorismate synthase 2, chloroplasti... 106 1e-25 KRH65927.1 hypothetical protein GLYMA_03G070600 [Glycine max] 104 1e-25 XP_016183751.1 PREDICTED: isochorismate synthase, chloroplastic-... 106 1e-25 XP_016198523.1 PREDICTED: isochorismate synthase 2, chloroplasti... 106 1e-25 XP_015960827.1 PREDICTED: isochorismate synthase 2, chloroplasti... 106 1e-25 XP_015960826.1 PREDICTED: isochorismate synthase 2, chloroplasti... 106 2e-25 XP_016183749.1 PREDICTED: isochorismate synthase, chloroplastic-... 106 2e-25 XP_016198521.1 PREDICTED: isochorismate synthase 2, chloroplasti... 106 2e-25 XP_016198519.1 PREDICTED: isochorismate synthase 2, chloroplasti... 106 2e-25 XP_015960824.1 PREDICTED: isochorismate synthase 2, chloroplasti... 106 2e-25 XP_015950017.1 PREDICTED: isochorismate synthase, chloroplastic-... 104 5e-25 KRH65925.1 hypothetical protein GLYMA_03G070600 [Glycine max] 104 5e-25 XP_014629098.1 PREDICTED: isochorismate synthase, chloroplastic ... 104 5e-25 KHN16367.1 Isochorismate synthase, chloroplastic [Glycine soja] 104 6e-25 KYP62896.1 hypothetical protein KK1_017456 [Cajanus cajan] 104 6e-25 KRH65926.1 hypothetical protein GLYMA_03G070600 [Glycine max] 104 6e-25 XP_006576607.2 PREDICTED: isochorismate synthase, chloroplastic ... 104 6e-25 XP_015950016.1 PREDICTED: isochorismate synthase, chloroplastic-... 104 7e-25 >XP_003607323.2 isochorismate synthase [Medicago truncatula] AES89520.2 isochorismate synthase [Medicago truncatula] Length = 567 Score = 107 bits (268), Expect = 5e-26 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG SLALDRQ ELDLLTSPKDDIEFTIVRE+IRRKLEAVCEKV+I+PKKMIRK Sbjct: 378 LAGTRARGPSLALDRQIELDLLTSPKDDIEFTIVRESIRRKLEAVCEKVIIEPKKMIRK 436 >XP_016198524.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X4 [Arachis ipaensis] XP_016198525.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X4 [Arachis ipaensis] Length = 463 Score = 106 bits (264), Expect = 1e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 372 LAGTRARGVSMALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 430 >XP_015960828.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X4 [Arachis duranensis] Length = 463 Score = 106 bits (264), Expect = 1e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 372 LAGTRARGVSIALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 430 >KRH65927.1 hypothetical protein GLYMA_03G070600 [Glycine max] Length = 344 Score = 104 bits (260), Expect = 1e-25 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS ALD Q ELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVI+P+KMIRK Sbjct: 199 LAGTRARGASQALDLQIELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIKPEKMIRK 257 >XP_016183751.1 PREDICTED: isochorismate synthase, chloroplastic-like isoform X2 [Arachis ipaensis] Length = 482 Score = 106 bits (264), Expect = 1e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 365 LAGTRARGVSMALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 423 >XP_016198523.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X3 [Arachis ipaensis] Length = 489 Score = 106 bits (264), Expect = 1e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 372 LAGTRARGVSMALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 430 >XP_015960827.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X3 [Arachis duranensis] Length = 489 Score = 106 bits (264), Expect = 1e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 372 LAGTRARGVSIALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 430 >XP_015960826.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X2 [Arachis duranensis] Length = 508 Score = 106 bits (264), Expect = 2e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 319 LAGTRARGVSIALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 377 >XP_016183749.1 PREDICTED: isochorismate synthase, chloroplastic-like isoform X1 [Arachis ipaensis] Length = 554 Score = 106 bits (264), Expect = 2e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 365 LAGTRARGVSMALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 423 >XP_016198521.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X2 [Arachis ipaensis] Length = 560 Score = 106 bits (264), Expect = 2e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 372 LAGTRARGVSMALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 430 >XP_016198519.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016198520.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X1 [Arachis ipaensis] Length = 561 Score = 106 bits (264), Expect = 2e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 372 LAGTRARGVSMALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 430 >XP_015960824.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X1 [Arachis duranensis] XP_015960825.1 PREDICTED: isochorismate synthase 2, chloroplastic-like isoform X1 [Arachis duranensis] Length = 561 Score = 106 bits (264), Expect = 2e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARG S+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCEKVVI+PKKMIRK Sbjct: 372 LAGTRARGVSIALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCEKVVIKPKKMIRK 430 >XP_015950017.1 PREDICTED: isochorismate synthase, chloroplastic-like isoform X2 [Arachis duranensis] XP_015950018.1 PREDICTED: isochorismate synthase, chloroplastic-like isoform X2 [Arachis duranensis] Length = 482 Score = 104 bits (260), Expect = 5e-25 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCE V+I+PKKMIRK Sbjct: 365 LAGTRARGASMALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCENVMIKPKKMIRK 423 >KRH65925.1 hypothetical protein GLYMA_03G070600 [Glycine max] Length = 482 Score = 104 bits (260), Expect = 5e-25 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS ALD Q ELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVI+P+KMIRK Sbjct: 293 LAGTRARGASQALDLQIELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIKPEKMIRK 351 >XP_014629098.1 PREDICTED: isochorismate synthase, chloroplastic isoform X3 [Glycine max] Length = 487 Score = 104 bits (260), Expect = 5e-25 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS ALD Q ELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVI+P+KMIRK Sbjct: 376 LAGTRARGASQALDLQIELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIKPEKMIRK 434 >KHN16367.1 Isochorismate synthase, chloroplastic [Glycine soja] Length = 504 Score = 104 bits (260), Expect = 6e-25 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS ALD Q ELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVI+P+KMIRK Sbjct: 376 LAGTRARGASQALDLQIELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIKPEKMIRK 434 >KYP62896.1 hypothetical protein KK1_017456 [Cajanus cajan] Length = 515 Score = 104 bits (260), Expect = 6e-25 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS LDRQ ELDLLTSPKDDIEFTIVR+TIRRKLEAVCEKVVI+P+KMIRK Sbjct: 326 LAGTRARGASQTLDRQIELDLLTSPKDDIEFTIVRDTIRRKLEAVCEKVVIKPEKMIRK 384 >KRH65926.1 hypothetical protein GLYMA_03G070600 [Glycine max] Length = 521 Score = 104 bits (260), Expect = 6e-25 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS ALD Q ELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVI+P+KMIRK Sbjct: 376 LAGTRARGASQALDLQIELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIKPEKMIRK 434 >XP_006576607.2 PREDICTED: isochorismate synthase, chloroplastic isoform X2 [Glycine max] KRH65928.1 hypothetical protein GLYMA_03G070600 [Glycine max] Length = 522 Score = 104 bits (260), Expect = 6e-25 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS ALD Q ELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVI+P+KMIRK Sbjct: 376 LAGTRARGASQALDLQIELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIKPEKMIRK 434 >XP_015950016.1 PREDICTED: isochorismate synthase, chloroplastic-like isoform X1 [Arachis duranensis] Length = 554 Score = 104 bits (260), Expect = 7e-25 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = -2 Query: 178 LAGTRARGASLALDRQTELDLLTSPKDDIEFTIVRETIRRKLEAVCEKVVIQPKKMIRK 2 LAGTRARGAS+ALDRQ ELDLLTSPKDDIEFTIVR+TIRRKLE VCE V+I+PKKMIRK Sbjct: 365 LAGTRARGASMALDRQIELDLLTSPKDDIEFTIVRDTIRRKLEGVCENVMIKPKKMIRK 423