BLASTX nr result
ID: Glycyrrhiza28_contig00017084
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00017084 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_006023158.1 MULTISPECIES: transposase [Rhizobiales] ABS65507.... 100 7e-25 WP_054732953.1 MULTISPECIES: transposase [Sphingomonadaceae] ALJ... 90 6e-21 EIE49924.1 transposase [Citreicella sp. 357] 88 9e-21 ENP46019.1 hypothetical protein C082_00459, partial [Brucella ab... 86 3e-20 ENP34683.1 hypothetical protein C088_02356, partial [Brucella ab... 86 3e-20 ENQ11738.1 hypothetical protein C083_00397, partial [Brucella ab... 86 3e-20 ENQ62975.1 hypothetical protein C045_01616, partial [Brucella me... 86 3e-20 ENS24313.1 hypothetical protein C081_00396, partial [Brucella ab... 86 3e-20 EPG15004.1 hypothetical protein L262_00526, partial [Brucella ab... 86 4e-20 WP_074443752.1 transposase [Rhizobiales bacterium HL-109] SCC794... 88 4e-20 EHR24264.1 hypothetical protein M1E_01333, partial [Brucella abo... 86 5e-20 WP_037207900.1 transposase [Rhodovulum sp. NI22] KGB82082.1 tran... 88 5e-20 WP_009502970.1 transposase [Citreicella sp. 357] EIE52584.1 ISBm... 88 5e-20 SDR59387.1 Transposase [Rhizobiales bacterium GAS113] 88 5e-20 ENS70749.1 hypothetical protein C060_02814, partial [Brucella me... 86 5e-20 ENQ03470.1 hypothetical protein C031_02644 [Brucella abortus F6/... 86 6e-20 ENP36384.1 hypothetical protein C088_00456, partial [Brucella ab... 86 6e-20 ENS30603.1 hypothetical protein C054_00460, partial [Brucella ab... 86 6e-20 WP_023081157.1 transposase, partial [Brucella abortus] ERT97785.... 86 7e-20 ENS65637.1 hypothetical protein C003_01576, partial [Brucella me... 86 7e-20 >WP_006023158.1 MULTISPECIES: transposase [Rhizobiales] ABS65507.1 ISBm1, transposase orfA [Xanthobacter autotrophicus Py2] ABS67919.1 ISBm1, transposase orfA [Xanthobacter autotrophicus Py2] EKS34547.1 hypothetical protein HMPREF9695_04457 [Afipia broomeae ATCC 49717] Length = 132 Score = 100 bits (248), Expect = 7e-25 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG Sbjct: 1 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 46 >WP_054732953.1 MULTISPECIES: transposase [Sphingomonadaceae] ALJ11941.1 transposase [Sphingopyxis macrogoltabida] ALJ12448.1 transposase [Sphingopyxis macrogoltabida] ALJ14761.1 transposase [Sphingopyxis macrogoltabida] KXU31217.1 transposase [Sphingobium sp. AM] KYC34219.1 transposase [Sphingobium sp. 22B] AMU88124.1 transposase [Sphingopyxis macrogoltabida] AMU90073.1 transposase [Sphingopyxis macrogoltabida] AMU91017.1 transposase [Sphingopyxis macrogoltabida] OAP33829.1 transposase [Sphingomonas paucimobilis] Length = 132 Score = 90.1 bits (222), Expect = 6e-21 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE++DFEWS+I PLLPNKPRGVARVDDRRVLNGIFWRLRTG Sbjct: 1 MSVRRYELSDFEWSVIEPLLPNKPRGVARVDDRRVLNGIFWRLRTG 46 >EIE49924.1 transposase [Citreicella sp. 357] Length = 71 Score = 87.8 bits (216), Expect = 9e-21 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TDFEWSII PLLPNKPRGV RVDDR+VLNGI+WRLRTG Sbjct: 1 MAQRRYELTDFEWSIIEPLLPNKPRGVPRVDDRKVLNGIYWRLRTG 46 >ENP46019.1 hypothetical protein C082_00459, partial [Brucella abortus 80/102] Length = 47 Score = 85.9 bits (211), Expect = 3e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >ENP34683.1 hypothetical protein C088_02356, partial [Brucella abortus 65/110] Length = 48 Score = 85.9 bits (211), Expect = 3e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >ENQ11738.1 hypothetical protein C083_00397, partial [Brucella abortus LEVI237] Length = 50 Score = 85.9 bits (211), Expect = 3e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >ENQ62975.1 hypothetical protein C045_01616, partial [Brucella melitensis 64/150] Length = 52 Score = 85.9 bits (211), Expect = 3e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >ENS24313.1 hypothetical protein C081_00396, partial [Brucella abortus F5/04-7] Length = 53 Score = 85.9 bits (211), Expect = 3e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >EPG15004.1 hypothetical protein L262_00526, partial [Brucella abortus 89-0363] Length = 55 Score = 85.9 bits (211), Expect = 4e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >WP_074443752.1 transposase [Rhizobiales bacterium HL-109] SCC79444.1 Transposase [Rhizobiales bacterium HL-109] Length = 140 Score = 88.2 bits (217), Expect = 4e-20 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M PRRYE++DFEWSII PLLPNKPRGV R DDR+VLNGI+WRLRTG Sbjct: 1 MSPRRYELSDFEWSIIEPLLPNKPRGVPRADDRKVLNGIYWRLRTG 46 >EHR24264.1 hypothetical protein M1E_01333, partial [Brucella abortus bv. 1 str. NI488] Length = 66 Score = 85.9 bits (211), Expect = 5e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >WP_037207900.1 transposase [Rhodovulum sp. NI22] KGB82082.1 transposase [Rhodovulum sp. NI22] Length = 134 Score = 87.8 bits (216), Expect = 5e-20 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TDFEWSII PLLPNKPRGV RVDDR+VLNGI+WRLRTG Sbjct: 1 MAQRRYELTDFEWSIIEPLLPNKPRGVPRVDDRKVLNGIYWRLRTG 46 >WP_009502970.1 transposase [Citreicella sp. 357] EIE52584.1 ISBm1, transposase orfA [Citreicella sp. 357] Length = 134 Score = 87.8 bits (216), Expect = 5e-20 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TDFEWSII PLLPNKPRGV RVDDR+VLNGI+WRLRTG Sbjct: 1 MAQRRYELTDFEWSIIEPLLPNKPRGVPRVDDRKVLNGIYWRLRTG 46 >SDR59387.1 Transposase [Rhizobiales bacterium GAS113] Length = 135 Score = 87.8 bits (216), Expect = 5e-20 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TDFEWSIIAPLLP+KPRGV R DDRRVLNGI+WRLRTG Sbjct: 1 MSARRYELTDFEWSIIAPLLPDKPRGVPRADDRRVLNGIYWRLRTG 46 >ENS70749.1 hypothetical protein C060_02814, partial [Brucella melitensis UK22/04] Length = 71 Score = 85.9 bits (211), Expect = 5e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >ENQ03470.1 hypothetical protein C031_02644 [Brucella abortus F6/05-2] ENR83512.1 hypothetical protein B996_02610 [Brucella abortus 78/14] ENS03021.1 hypothetical protein B974_02622 [Brucella abortus 87/28] ENS27032.1 hypothetical protein C054_02859 [Brucella abortus F6/05-4] ENS31252.1 hypothetical protein C087_03001 [Brucella abortus F6/05-9] Length = 74 Score = 85.9 bits (211), Expect = 6e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >ENP36384.1 hypothetical protein C088_00456, partial [Brucella abortus 65/110] Length = 74 Score = 85.9 bits (211), Expect = 6e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >ENS30603.1 hypothetical protein C054_00460, partial [Brucella abortus F6/05-4] Length = 77 Score = 85.9 bits (211), Expect = 6e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >WP_023081157.1 transposase, partial [Brucella abortus] ERT97785.1 hypothetical protein P038_02741, partial [Brucella abortus 99-9971-135] Length = 78 Score = 85.9 bits (211), Expect = 7e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46 >ENS65637.1 hypothetical protein C003_01576, partial [Brucella melitensis F9/05] Length = 79 Score = 85.9 bits (211), Expect = 7e-20 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +2 Query: 200 MKPRRYEITDFEWSIIAPLLPNKPRGVARVDDRRVLNGIFWRLRTG 337 M RRYE+TD EWSII+PLLPNKPRGVARVDDRRVLNGI WR RTG Sbjct: 1 MTRRRYELTDHEWSIISPLLPNKPRGVARVDDRRVLNGILWRFRTG 46