BLASTX nr result
ID: Glycyrrhiza28_contig00016999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016999 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU25790.1 hypothetical protein TSUD_222480 [Trifolium subterran... 53 9e-06 >GAU25790.1 hypothetical protein TSUD_222480 [Trifolium subterraneum] Length = 360 Score = 52.8 bits (125), Expect = 9e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 95 MKATSVASGGIVPQVLTKDNFERWSVVMQNY 3 +K+T+VASGGIV QVLTKDN+ERW VMQNY Sbjct: 2 VKSTAVASGGIVHQVLTKDNYERWRGVMQNY 32