BLASTX nr result
ID: Glycyrrhiza28_contig00016971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016971 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH23509.1 hypothetical protein GLYMA_13G361300 [Glycine max] KR... 52 1e-06 OEL19012.1 hypothetical protein BAE44_0019970 [Dichanthelium oli... 51 2e-06 ACG29605.1 hypothetical protein [Zea mays] 51 3e-06 KQL13799.1 hypothetical protein SETIT_024718mg, partial [Setaria... 51 3e-06 KYP58344.1 hypothetical protein KK1_013746 [Cajanus cajan] 51 4e-06 KQK07229.1 hypothetical protein BRADI_2g34047 [Brachypodium dist... 50 5e-06 XP_015869366.1 PREDICTED: uncharacterized protein LOC107406703 [... 50 6e-06 KHM98783.1 hypothetical protein glysoja_030836 [Glycine soja] KR... 50 9e-06 >KRH23509.1 hypothetical protein GLYMA_13G361300 [Glycine max] KRH23510.1 hypothetical protein GLYMA_13G361300 [Glycine max] Length = 56 Score = 52.4 bits (124), Expect = 1e-06 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = +3 Query: 72 TAQPPAQQQMSYYDHVQTRHEEKGGLYA 155 T PAQQQMSYYDHVQTRH+EKG LY+ Sbjct: 2 TGSAPAQQQMSYYDHVQTRHQEKGSLYS 29 >OEL19012.1 hypothetical protein BAE44_0019970 [Dichanthelium oligosanthes] Length = 29 Score = 51.2 bits (121), Expect = 2e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +3 Query: 81 PPAQQQMSYYDHVQTRHEEKGGLYAW 158 PP+ Q MSYYDHVQ RHEEKG LYAW Sbjct: 4 PPSAQDMSYYDHVQKRHEEKGCLYAW 29 >ACG29605.1 hypothetical protein [Zea mays] Length = 33 Score = 50.8 bits (120), Expect = 3e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +3 Query: 81 PPAQQQMSYYDHVQTRHEEKGGLYAW 158 PP+ Q MSYYDHVQ RHEEKG LYAW Sbjct: 4 PPSGQDMSYYDHVQKRHEEKGCLYAW 29 >KQL13799.1 hypothetical protein SETIT_024718mg, partial [Setaria italica] Length = 51 Score = 51.2 bits (121), Expect = 3e-06 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +3 Query: 81 PPAQQQMSYYDHVQTRHEEKGGLYAW 158 PP+ Q MSYYDHVQ RHEEKG LYAW Sbjct: 26 PPSAQDMSYYDHVQKRHEEKGCLYAW 51 >KYP58344.1 hypothetical protein KK1_013746 [Cajanus cajan] Length = 56 Score = 50.8 bits (120), Expect = 4e-06 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +3 Query: 72 TAQPPAQQQMSYYDHVQTRHEEKGGLYA 155 T PAQQ+MSYYDHVQ RHEEKG LYA Sbjct: 2 TGSAPAQQKMSYYDHVQMRHEEKGSLYA 29 >KQK07229.1 hypothetical protein BRADI_2g34047 [Brachypodium distachyon] Length = 29 Score = 50.1 bits (118), Expect = 5e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +3 Query: 81 PPAQQQMSYYDHVQTRHEEKGGLYAW 158 PP+ Q MSYYDHVQ RHE+KG LYAW Sbjct: 4 PPSAQDMSYYDHVQKRHEDKGCLYAW 29 >XP_015869366.1 PREDICTED: uncharacterized protein LOC107406703 [Ziziphus jujuba] Length = 56 Score = 50.4 bits (119), Expect = 6e-06 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = +3 Query: 72 TAQPPAQQQMSYYDHVQTRHEEKGGLYAW 158 +++ PA QQMSYYDHV+ RH+EKG LYAW Sbjct: 2 SSEAPAHQQMSYYDHVRKRHDEKGCLYAW 30 >KHM98783.1 hypothetical protein glysoja_030836 [Glycine soja] KRH09807.1 hypothetical protein GLYMA_15G012600 [Glycine max] Length = 56 Score = 50.1 bits (118), Expect = 9e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 63 IMGTAQPPAQQQMSYYDHVQTRHEEKGGLYA 155 +MG+A PAQQQMSYYDHVQTR EEKG YA Sbjct: 1 MMGSA--PAQQQMSYYDHVQTRREEKGSFYA 29