BLASTX nr result
ID: Glycyrrhiza28_contig00016906
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016906 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004490692.1 PREDICTED: uncharacterized protein LOC101510207 [... 60 5e-09 XP_004490670.1 PREDICTED: uncharacterized protein LOC101500706 i... 60 7e-09 XP_004490669.1 PREDICTED: uncharacterized protein LOC101500706 i... 60 7e-09 XP_004490668.1 PREDICTED: uncharacterized protein LOC101500706 i... 60 7e-09 XP_003615884.1 exocyst subunit exo70 family protein [Medicago tr... 59 2e-08 XP_013460248.1 exocyst subunit exo70 family protein [Medicago tr... 58 3e-08 XP_003615919.1 exocyst subunit exo70 family protein [Medicago tr... 56 2e-07 XP_003615953.1 transmembrane protein, putative [Medicago truncat... 56 2e-07 XP_003615916.1 exocyst subunit exo70 family protein [Medicago tr... 55 6e-07 XP_016164508.1 PREDICTED: uncharacterized protein LOC107607033 [... 54 1e-06 XP_003615928.1 exocyst subunit exo70 family protein [Medicago tr... 54 1e-06 XP_003615886.1 exocyst subunit exo70 family protein [Medicago tr... 54 1e-06 XP_019456369.1 PREDICTED: exocyst complex component EXO70B1-like... 54 1e-06 XP_019456368.1 PREDICTED: exocyst complex component EXO70B1-like... 54 1e-06 XP_003615885.1 transmembrane protein, putative [Medicago truncat... 53 2e-06 XP_003615934.1 exocyst subunit exo70 family protein [Medicago tr... 53 3e-06 XP_003617614.1 exocyst subunit exo70 family protein [Medicago tr... 52 4e-06 XP_015931964.1 PREDICTED: exocyst complex component EXO70B1-like... 52 4e-06 XP_003615913.1 transmembrane protein, putative [Medicago truncat... 52 6e-06 XP_003615906.1 transmembrane protein, putative [Medicago truncat... 52 7e-06 >XP_004490692.1 PREDICTED: uncharacterized protein LOC101510207 [Cicer arietinum] Length = 277 Score = 60.1 bits (144), Expect = 5e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MTP+LIQI WLM P+VWRF GFASAVVGLLCY Sbjct: 1 MTPILIQIWRWLMHPKVWRFGGFASAVVGLLCY 33 >XP_004490670.1 PREDICTED: uncharacterized protein LOC101500706 isoform X3 [Cicer arietinum] Length = 834 Score = 60.1 bits (144), Expect = 7e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MTP+LIQI WLM P+VWRF GFASAVVGLLCY Sbjct: 1 MTPILIQIWRWLMHPKVWRFGGFASAVVGLLCY 33 >XP_004490669.1 PREDICTED: uncharacterized protein LOC101500706 isoform X2 [Cicer arietinum] Length = 999 Score = 60.1 bits (144), Expect = 7e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MTP+LIQI WLM P+VWRF GFASAVVGLLCY Sbjct: 1 MTPILIQIWRWLMHPKVWRFGGFASAVVGLLCY 33 >XP_004490668.1 PREDICTED: uncharacterized protein LOC101500706 isoform X1 [Cicer arietinum] Length = 1009 Score = 60.1 bits (144), Expect = 7e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MTP+LIQI WLM P+VWRF GFASAVVGLLCY Sbjct: 1 MTPILIQIWRWLMHPKVWRFGGFASAVVGLLCY 33 >XP_003615884.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98842.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 697 Score = 58.5 bits (140), Expect = 2e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MT +LIQI WLMQP+VWRFVGFAS VVGL+CY Sbjct: 1 MTNILIQIWRWLMQPKVWRFVGFASVVVGLVCY 33 >XP_013460248.1 exocyst subunit exo70 family protein [Medicago truncatula] KEH34279.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 681 Score = 58.2 bits (139), Expect = 3e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 M P+LIQI WLMQ +VWRFVGFASA+VGL+CY Sbjct: 1 MMPILIQILRWLMQEKVWRFVGFASAIVGLVCY 33 >XP_003615919.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98877.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 431 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 M P++IQIR WL++ +VWRFVGF SA VGL+CY Sbjct: 1 MIPLIIQIRCWLLETKVWRFVGFVSAAVGLICY 33 >XP_003615953.1 transmembrane protein, putative [Medicago truncatula] AES98911.1 transmembrane protein, putative [Medicago truncatula] Length = 530 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MT +++QI W +QP+VWRFVGFAS++VGLLCY Sbjct: 1 MTSIVVQIWRWFLQPKVWRFVGFASSIVGLLCY 33 >XP_003615916.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98874.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 712 Score = 54.7 bits (130), Expect = 6e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 M P++I+IRM L+Q +VWRFVGFASA VGLLCY Sbjct: 1 MIPVIIRIRMCLLQTKVWRFVGFASAAVGLLCY 33 >XP_016164508.1 PREDICTED: uncharacterized protein LOC107607033 [Arachis ipaensis] Length = 414 Score = 53.9 bits (128), Expect = 1e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MTP+ +QI WLM ++WRF+GFAS++VGLLCY Sbjct: 1 MTPLSVQIPSWLMHQKLWRFLGFASSIVGLLCY 33 >XP_003615928.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98886.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 750 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 Query: 129 MLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 M+I+I+ WLMQ +VWRFVGFASA VGLLCY Sbjct: 5 MVIKIQRWLMQTKVWRFVGFASAAVGLLCY 34 >XP_003615886.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98844.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 625 Score = 53.5 bits (127), Expect = 1e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 M +LIQ W+MQP+VWRFVGFAS+ +GLLCY Sbjct: 1 MAHILIQTWRWMMQPKVWRFVGFASSAIGLLCY 33 >XP_019456369.1 PREDICTED: exocyst complex component EXO70B1-like [Lupinus angustifolius] OIW04389.1 hypothetical protein TanjilG_32581 [Lupinus angustifolius] Length = 726 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 M P+ IR WLMQ E+WR VGF SAVVGLLCY Sbjct: 1 MIPVSTHIRRWLMQTEIWRIVGFVSAVVGLLCY 33 >XP_019456368.1 PREDICTED: exocyst complex component EXO70B1-like [Lupinus angustifolius] Length = 772 Score = 53.5 bits (127), Expect = 1e-06 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 3/47 (6%) Frame = +3 Query: 87 VKVIVTQFKEI---MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 VK I+T ++ M P+ +I+ WLMQ E+WR VGF SA+VGLLCY Sbjct: 12 VKAILTHTIDLIKNMIPVSARIQRWLMQTEIWRIVGFVSAIVGLLCY 58 >XP_003615885.1 transmembrane protein, putative [Medicago truncatula] AES98843.1 transmembrane protein, putative [Medicago truncatula] Length = 274 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MT +LIQI WLM P+V RFVGFASAV+GLLCY Sbjct: 1 MTRILIQIWRWLMHPKVCRFVGFASAVLGLLCY 33 >XP_003615934.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98892.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 502 Score = 52.8 bits (125), Expect = 3e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 129 MLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 M+I+IRMWL++ +VWRFV F SAV+GLLCY Sbjct: 1 MIIRIRMWLLKAKVWRFVSFVSAVIGLLCY 30 >XP_003617614.1 exocyst subunit exo70 family protein [Medicago truncatula] AET00573.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 575 Score = 52.4 bits (124), Expect = 4e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 129 MLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 MLI+++ WL+Q +VWRFVGFASA VGL+CY Sbjct: 5 MLIKVQRWLLQTKVWRFVGFASAAVGLVCY 34 >XP_015931964.1 PREDICTED: exocyst complex component EXO70B1-like [Arachis duranensis] Length = 701 Score = 52.4 bits (124), Expect = 4e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 M P+L QI+MWL P++W FV FASAV+GLLCY Sbjct: 1 MGPLLNQIKMWLKHPQLWSFVRFASAVLGLLCY 33 >XP_003615913.1 transmembrane protein, putative [Medicago truncatula] AES98871.1 transmembrane protein, putative [Medicago truncatula] Length = 272 Score = 51.6 bits (122), Expect = 6e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 129 MLIQIRMWLMQPEVWRFVGFASAVVGLLCY 218 ML+QI+ WLM +VWRFVG ASAVVGL+CY Sbjct: 5 MLVQIQRWLMHTKVWRFVGCASAVVGLVCY 34 >XP_003615906.1 transmembrane protein, putative [Medicago truncatula] AES98864.1 transmembrane protein, putative [Medicago truncatula] Length = 429 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +3 Query: 120 MTPMLIQIRMWLMQPEVWRFVGFASAVVGLLC 215 M +L QI W+MQP+VWRF+GFA+AVVGLLC Sbjct: 1 MKHILFQIWRWMMQPKVWRFLGFAAAVVGLLC 32