BLASTX nr result
ID: Glycyrrhiza28_contig00016774
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016774 (645 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013464157.1 hypothetical protein MTR_2g062865 [Medicago trunc... 55 1e-06 >XP_013464157.1 hypothetical protein MTR_2g062865 [Medicago truncatula] KEH38192.1 hypothetical protein MTR_2g062865 [Medicago truncatula] Length = 94 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -1 Query: 393 LGFNSTPQN*LVR*GLSKPYKHYLGHISRRCGTKHNPSNPTQ 268 +G NST Q+ L+R GL + YKHY HISR+CGTK PS+PTQ Sbjct: 53 VGPNSTLQDWLIRRGLPELYKHYTAHISRQCGTKLKPSHPTQ 94