BLASTX nr result
ID: Glycyrrhiza28_contig00016367
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016367 (204 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003610558.1 phloem filament protein PP1 [Medicago truncatula]... 67 6e-13 XP_014508270.1 PREDICTED: cysteine proteinase inhibitor 1-like [... 66 2e-12 XP_007154019.1 hypothetical protein PHAVU_003G084300g [Phaseolus... 66 2e-12 XP_017431802.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 64 1e-11 AJD79055.1 CPI-4 [Morus alba var. atropurpurea] 64 1e-11 XP_007147650.1 hypothetical protein PHAVU_006G142600g [Phaseolus... 64 1e-11 XP_010094696.1 Cysteine proteinase inhibitor 5 [Morus notabilis]... 63 4e-11 XP_012090836.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 61 1e-10 XP_012090835.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 61 1e-10 XP_017434771.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 60 3e-10 XP_016197537.1 PREDICTED: cysteine proteinase inhibitor 1 [Arach... 60 3e-10 XP_015959005.1 PREDICTED: cysteine proteinase inhibitor 1-like [... 60 3e-10 BAT87537.1 hypothetical protein VIGAN_05091900 [Vigna angularis ... 60 3e-10 XP_004517283.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 60 4e-10 XP_019425190.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 60 4e-10 KHN32962.1 Cysteine proteinase inhibitor 1 [Glycine soja] 60 6e-10 XP_003546187.1 PREDICTED: cysteine proteinase inhibitor 1 [Glyci... 60 6e-10 XP_015941654.1 PREDICTED: cysteine proteinase inhibitor 1-like [... 59 8e-10 XP_017644754.1 PREDICTED: cysteine proteinase inhibitor 5-like [... 59 1e-09 XP_012450315.1 PREDICTED: cysteine proteinase inhibitor 1-like [... 59 1e-09 >XP_003610558.1 phloem filament protein PP1 [Medicago truncatula] AES92755.1 phloem filament protein PP1 [Medicago truncatula] Length = 117 Score = 67.4 bits (163), Expect = 6e-13 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AGTNYRL L+A+ GS+S Y+A+VWEK+WQH+RNLTSF P Sbjct: 75 AGTNYRLTLSASDGSYSKNYEAVVWEKIWQHFRNLTSFVP 114 >XP_014508270.1 PREDICTED: cysteine proteinase inhibitor 1-like [Vigna radiata var. radiata] Length = 115 Score = 66.2 bits (160), Expect = 2e-12 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AG NYRLIL A+ GS SN Y+AIVWEK WQH+RNL+SF P Sbjct: 73 AGVNYRLILAASDGSSSNNYEAIVWEKTWQHFRNLSSFTP 112 >XP_007154019.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] XP_007154020.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] ESW26013.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] ESW26014.1 hypothetical protein PHAVU_003G084300g [Phaseolus vulgaris] Length = 115 Score = 66.2 bits (160), Expect = 2e-12 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AG NYRL L A GS SN Y+AIVWEK+WQH+RNLTSF P Sbjct: 73 AGVNYRLTLAATDGSSSNNYEAIVWEKVWQHFRNLTSFTP 112 >XP_017431802.1 PREDICTED: cysteine proteinase inhibitor 5-like [Vigna angularis] KOM33690.1 hypothetical protein LR48_Vigan01g324600 [Vigna angularis] BAT77323.1 hypothetical protein VIGAN_01542400 [Vigna angularis var. angularis] Length = 115 Score = 64.3 bits (155), Expect = 1e-11 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AG NYRL L A GS SN Y+AIVWEK WQH+RNLTSF P Sbjct: 73 AGLNYRLTLAAADGSSSNNYEAIVWEKAWQHFRNLTSFTP 112 >AJD79055.1 CPI-4 [Morus alba var. atropurpurea] Length = 114 Score = 63.9 bits (154), Expect = 1e-11 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AGTNYRL+L G+ + Y+A+VWEK WQH+RNLTSFKP Sbjct: 73 AGTNYRLVLAVKNGATAERYEAVVWEKPWQHFRNLTSFKP 112 >XP_007147650.1 hypothetical protein PHAVU_006G142600g [Phaseolus vulgaris] ESW19644.1 hypothetical protein PHAVU_006G142600g [Phaseolus vulgaris] Length = 116 Score = 63.9 bits (154), Expect = 1e-11 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFK 87 AGTNYRL+L A GGS + Y+A+VWEK W H+RNLTSFK Sbjct: 73 AGTNYRLVLKAKGGSATTQYEAVVWEKTWVHFRNLTSFK 111 >XP_010094696.1 Cysteine proteinase inhibitor 5 [Morus notabilis] EXB56668.1 Cysteine proteinase inhibitor 5 [Morus notabilis] Length = 114 Score = 62.8 bits (151), Expect = 4e-11 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AGTNYRL++ G+ + Y+A+VWEK WQH+RNLTSFKP Sbjct: 73 AGTNYRLVVAVTNGAAAERYEAVVWEKPWQHFRNLTSFKP 112 >XP_012090836.1 PREDICTED: cysteine proteinase inhibitor 5-like [Jatropha curcas] KDP21895.1 hypothetical protein JCGZ_03033 [Jatropha curcas] Length = 111 Score = 61.2 bits (147), Expect = 1e-10 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AGTNYRL+L NGG+ S Y+A+VWEK W++++NLTSFKP Sbjct: 70 AGTNYRLVLEVNGGA-SKDYEAVVWEKTWENFKNLTSFKP 108 >XP_012090835.1 PREDICTED: cysteine proteinase inhibitor 5-like [Jatropha curcas] KDP21894.1 hypothetical protein JCGZ_03032 [Jatropha curcas] Length = 111 Score = 61.2 bits (147), Expect = 1e-10 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AGTNYRL+L NGG+ S Y+A+VWEK W++++NLTSFKP Sbjct: 70 AGTNYRLVLEVNGGA-SKDYEAVVWEKTWENFKNLTSFKP 108 >XP_017434771.1 PREDICTED: cysteine proteinase inhibitor 5-like [Vigna angularis] KOM53321.1 hypothetical protein LR48_Vigan09g198000 [Vigna angularis] Length = 113 Score = 60.5 bits (145), Expect = 3e-10 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AGTNYRL+L GGS + Y+A+VWEK W +++NLTSFKP Sbjct: 71 AGTNYRLVLKTKGGSATTNYEAVVWEKPWLNFKNLTSFKP 110 >XP_016197537.1 PREDICTED: cysteine proteinase inhibitor 1 [Arachis ipaensis] Length = 116 Score = 60.5 bits (145), Expect = 3e-10 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AGTNYRL L A GS + YQA+VWEK W+H++NLTSF P Sbjct: 75 AGTNYRLDLKATDGSKTQDYQAVVWEKPWEHFKNLTSFTP 114 >XP_015959005.1 PREDICTED: cysteine proteinase inhibitor 1-like [Arachis duranensis] Length = 116 Score = 60.5 bits (145), Expect = 3e-10 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSF 90 AGTNYRL+L A GS + YQA+VWEK W+H++NLTSF Sbjct: 75 AGTNYRLVLKATDGSKTQDYQAVVWEKPWEHFKNLTSF 112 >BAT87537.1 hypothetical protein VIGAN_05091900 [Vigna angularis var. angularis] Length = 117 Score = 60.5 bits (145), Expect = 3e-10 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 AGTNYRL+L GGS + Y+A+VWEK W +++NLTSFKP Sbjct: 75 AGTNYRLVLKTKGGSATTNYEAVVWEKPWLNFKNLTSFKP 114 >XP_004517283.1 PREDICTED: cysteine proteinase inhibitor 5-like [Cicer arietinum] Length = 114 Score = 60.1 bits (144), Expect = 4e-10 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSF 90 +G NYRL+L+AN GS SN Y+A+VWEK+W +RNLTSF Sbjct: 72 SGANYRLVLSANDGSVSNHYEAVVWEKVWLRFRNLTSF 109 >XP_019425190.1 PREDICTED: cysteine proteinase inhibitor 5-like [Lupinus angustifolius] OIV91844.1 hypothetical protein TanjilG_17836 [Lupinus angustifolius] Length = 115 Score = 60.1 bits (144), Expect = 4e-10 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 +GTNYR++L+AN G+ S YQA V+EK W HYRNLTSF P Sbjct: 73 SGTNYRIVLSANDGTASKKYQATVYEKPWAHYRNLTSFDP 112 >KHN32962.1 Cysteine proteinase inhibitor 1 [Glycine soja] Length = 112 Score = 59.7 bits (143), Expect = 6e-10 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 +GTNYRL+L A GS + Y+AIVWEK W H+ NLTSFKP Sbjct: 71 SGTNYRLVLKAKDGSATASYEAIVWEKPWLHFMNLTSFKP 110 >XP_003546187.1 PREDICTED: cysteine proteinase inhibitor 1 [Glycine max] KRH11536.1 hypothetical protein GLYMA_15G115300 [Glycine max] Length = 112 Score = 59.7 bits (143), Expect = 6e-10 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 +GTNYRL+L A GS + Y+AIVWEK W H+ NLTSFKP Sbjct: 71 SGTNYRLVLKAKDGSATASYEAIVWEKPWLHFMNLTSFKP 110 >XP_015941654.1 PREDICTED: cysteine proteinase inhibitor 1-like [Arachis duranensis] Length = 83 Score = 58.5 bits (140), Expect = 8e-10 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSFKP 84 +GTNYRLIL+A+ G ++ Y+AIVWEK WQ++R+LTSF P Sbjct: 41 SGTNYRLILSASSGFATSNYEAIVWEKPWQNFRSLTSFNP 80 >XP_017644754.1 PREDICTED: cysteine proteinase inhibitor 5-like [Gossypium arboreum] Length = 119 Score = 59.3 bits (142), Expect = 1e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSF 90 AGTNYRLIL A G+ N Y+A+VWEKLW ++RNLTSF Sbjct: 77 AGTNYRLILQAKEGTVDNTYKAVVWEKLWLNFRNLTSF 114 >XP_012450315.1 PREDICTED: cysteine proteinase inhibitor 1-like [Gossypium raimondii] XP_016753586.1 PREDICTED: cysteine proteinase inhibitor 1-like [Gossypium hirsutum] XP_016693326.1 PREDICTED: cysteine proteinase inhibitor 1-like [Gossypium hirsutum] KJB67378.1 hypothetical protein B456_010G187700 [Gossypium raimondii] Length = 119 Score = 59.3 bits (142), Expect = 1e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 203 AGTNYRLILTANGGSHSNIYQAIVWEKLWQHYRNLTSF 90 AGTNYRLIL A G+ N YQA+VWEKLW + RNLTSF Sbjct: 77 AGTNYRLILQAKKGAVDNTYQAVVWEKLWLNLRNLTSF 114