BLASTX nr result
ID: Glycyrrhiza28_contig00016212
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016212 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU21181.1 hypothetical protein TSUD_10980 [Trifolium subterraneum] 58 4e-07 XP_004498465.1 PREDICTED: nuclear pore complex protein NUP85 [Ci... 54 3e-06 >GAU21181.1 hypothetical protein TSUD_10980 [Trifolium subterraneum] Length = 707 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 225 LYSPVFRVDISWSRSNSLCVSLFAKPSGSPDVREGAKIVEVK 100 L P+ RV +SWSR NSL VSLFA+PSGS D +GAK++EVK Sbjct: 31 LVRPISRVALSWSRGNSLRVSLFAEPSGSSDAGDGAKVIEVK 72 >XP_004498465.1 PREDICTED: nuclear pore complex protein NUP85 [Cicer arietinum] Length = 709 Score = 53.9 bits (128), Expect(2) = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 225 LYSPVFRVDISWSRSNSLCVSLFAKPSGSPDVREGAKIVEVK 100 L P+ R+ ISWSR NSL VSLFA+PS +P+ +GAK+VEVK Sbjct: 31 LARPISRLAISWSRGNSLRVSLFAEPSVNPNTGDGAKVVEVK 72 Score = 24.3 bits (51), Expect(2) = 3e-06 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 50 SSPFALSKAPSQYHLD 3 SS LSK+PS YHLD Sbjct: 104 SSLSELSKSPSPYHLD 119