BLASTX nr result
ID: Glycyrrhiza28_contig00016192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00016192 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW85782.1 hypothetical protein EUGRSUZ_B02533 [Eucalyptus grandis] 101 3e-25 KZV57946.1 hypothetical protein F511_12102 [Dorcoceras hygrometr... 100 4e-25 KRX77736.1 60S ribosomal protein L37a [Trichinella patagoniensis] 100 4e-25 ACU13460.1 unknown [Glycine max] KRH57543.1 hypothetical protein... 100 4e-25 OIW10330.1 hypothetical protein TanjilG_28081 [Lupinus angustifo... 100 4e-25 EYU42328.1 hypothetical protein MIMGU_mgv1a0171311mg, partial [E... 100 6e-25 AFK48860.1 unknown [Medicago truncatula] 100 6e-25 KRH57542.1 hypothetical protein GLYMA_05G067400 [Glycine max] 100 7e-25 KDO57018.1 hypothetical protein CISIN_1g044880mg, partial [Citru... 100 8e-25 EYU42327.1 hypothetical protein MIMGU_mgv1a0171311mg, partial [E... 100 8e-25 GAV87271.1 Ribosomal_L37ae domain-containing protein, partial [C... 100 9e-25 XP_016445344.1 PREDICTED: 60S ribosomal protein L37a-like [Nicot... 100 9e-25 XP_011085665.1 PREDICTED: 60S ribosomal protein L37a [Sesamum in... 100 9e-25 XP_010692007.1 PREDICTED: 60S ribosomal protein L37a [Beta vulga... 100 9e-25 XP_008786203.1 PREDICTED: 60S ribosomal protein L37a [Phoenix da... 100 9e-25 XP_002282974.1 PREDICTED: 60S ribosomal protein L37a [Vitis vini... 100 9e-25 AFW90557.1 60S ribosomal protein L37a [Solanum tuberosum] 100 9e-25 XP_002526487.1 PREDICTED: 60S ribosomal protein L37a [Ricinus co... 100 9e-25 CAI48073.1 60S ribosomal protein L37a [Capsicum chinense] 100 9e-25 XP_015573669.1 PREDICTED: 60S ribosomal protein L37a isoform X1 ... 100 9e-25 >KCW85782.1 hypothetical protein EUGRSUZ_B02533 [Eucalyptus grandis] Length = 101 Score = 101 bits (252), Expect = 3e-25 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -3 Query: 368 LLQYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 ++QYAVKRK+VGIWGCKDCGK+KAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 51 MMQYAVKRKSVGIWGCKDCGKIKAGGAYTLNTASAVTVRSTIRRLREQTES 101 >KZV57946.1 hypothetical protein F511_12102 [Dorcoceras hygrometricum] Length = 64 Score = 100 bits (248), Expect = 4e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 16 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >KRX77736.1 60S ribosomal protein L37a [Trichinella patagoniensis] Length = 64 Score = 100 bits (248), Expect = 4e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 16 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >ACU13460.1 unknown [Glycine max] KRH57543.1 hypothetical protein GLYMA_05G067400 [Glycine max] Length = 64 Score = 100 bits (248), Expect = 4e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 16 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 64 >OIW10330.1 hypothetical protein TanjilG_28081 [Lupinus angustifolius] Length = 50 Score = 99.8 bits (247), Expect = 4e-25 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -3 Query: 365 LQYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTE 219 ++YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTE Sbjct: 1 MEYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTE 49 >EYU42328.1 hypothetical protein MIMGU_mgv1a0171311mg, partial [Erythranthe guttata] Length = 77 Score = 100 bits (248), Expect = 6e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 29 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 77 >AFK48860.1 unknown [Medicago truncatula] Length = 79 Score = 100 bits (248), Expect = 6e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 31 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 79 >KRH57542.1 hypothetical protein GLYMA_05G067400 [Glycine max] Length = 72 Score = 99.8 bits (247), Expect = 7e-25 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 359 YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 25 YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 72 >KDO57018.1 hypothetical protein CISIN_1g044880mg, partial [Citrus sinensis] Length = 91 Score = 100 bits (248), Expect = 8e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 43 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 91 >EYU42327.1 hypothetical protein MIMGU_mgv1a0171311mg, partial [Erythranthe guttata] Length = 91 Score = 100 bits (248), Expect = 8e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 43 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 91 >GAV87271.1 Ribosomal_L37ae domain-containing protein, partial [Cephalotus follicularis] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >XP_016445344.1 PREDICTED: 60S ribosomal protein L37a-like [Nicotiana tabacum] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >XP_011085665.1 PREDICTED: 60S ribosomal protein L37a [Sesamum indicum] XP_011093498.1 PREDICTED: 60S ribosomal protein L37a [Sesamum indicum] XP_012831458.1 PREDICTED: 60S ribosomal protein L37a isoform X1 [Erythranthe guttata] XP_012831459.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Erythranthe guttata] KZV45091.1 hypothetical protein F511_29412 [Dorcoceras hygrometricum] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >XP_010692007.1 PREDICTED: 60S ribosomal protein L37a [Beta vulgaris subsp. vulgaris] KMS99893.1 hypothetical protein BVRB_1g017410 [Beta vulgaris subsp. vulgaris] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >XP_008786203.1 PREDICTED: 60S ribosomal protein L37a [Phoenix dactylifera] XP_009392534.1 PREDICTED: 60S ribosomal protein L37a [Musa acuminata subsp. malaccensis] XP_009405729.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Musa acuminata subsp. malaccensis] XP_010933552.1 PREDICTED: 60S ribosomal protein L37a [Elaeis guineensis] XP_010941014.1 PREDICTED: 60S ribosomal protein L37a [Elaeis guineensis] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >XP_002282974.1 PREDICTED: 60S ribosomal protein L37a [Vitis vinifera] XP_004133971.1 PREDICTED: 60S ribosomal protein L37a [Cucumis sativus] XP_004148368.1 PREDICTED: 60S ribosomal protein L37a [Cucumis sativus] XP_004244552.1 PREDICTED: 60S ribosomal protein L37a [Solanum lycopersicum] XP_004245836.1 PREDICTED: 60S ribosomal protein L37a [Solanum lycopersicum] XP_004245837.1 PREDICTED: 60S ribosomal protein L37a [Solanum lycopersicum] XP_004248984.1 PREDICTED: 60S ribosomal protein L37a [Solanum lycopersicum] XP_006345354.1 PREDICTED: 60S ribosomal protein L37a [Solanum tuberosum] XP_006362483.1 PREDICTED: 60S ribosomal protein L37a [Solanum tuberosum] XP_006440143.1 hypothetical protein CICLE_v10023068mg [Citrus clementina] XP_006445466.1 hypothetical protein CICLE_v10022898mg [Citrus clementina] XP_006464390.1 PREDICTED: 60S ribosomal protein L37a [Citrus sinensis] XP_006477063.1 PREDICTED: 60S ribosomal protein L37a [Citrus sinensis] XP_007039638.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Theobroma cacao] XP_007052397.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Theobroma cacao] XP_007218651.1 hypothetical protein PRUPE_ppa013989mg [Prunus persica] XP_008229490.1 PREDICTED: 60S ribosomal protein L37a [Prunus mume] XP_008232335.1 PREDICTED: 60S ribosomal protein L37a [Prunus mume] XP_008373627.1 PREDICTED: 60S ribosomal protein L37a [Malus domestica] XP_008382254.1 PREDICTED: 60S ribosomal protein L37a [Malus domestica] XP_008389115.1 PREDICTED: 60S ribosomal protein L37a [Malus domestica] XP_008355544.1 PREDICTED: 60S ribosomal protein L37a [Malus domestica] XP_008438301.1 PREDICTED: 60S ribosomal protein L37a [Cucumis melo] XP_008457163.1 PREDICTED: 60S ribosomal protein L37a [Cucumis melo] XP_008465908.1 PREDICTED: 60S ribosomal protein L37a [Cucumis melo] XP_009371855.1 PREDICTED: 60S ribosomal protein L37a [Pyrus x bretschneideri] XP_009375382.1 PREDICTED: 60S ribosomal protein L37a [Pyrus x bretschneideri] XP_009378386.1 PREDICTED: 60S ribosomal protein L37a [Pyrus x bretschneideri] XP_009607073.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] XP_009593570.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] XP_009597850.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] XP_009600968.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] XP_009601940.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] XP_009791162.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] XP_009792526.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] XP_009796147.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] XP_009796644.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] XP_009797153.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] XP_011649070.1 PREDICTED: 60S ribosomal protein L37a [Cucumis sativus] XP_012075395.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Jatropha curcas] XP_012083739.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Jatropha curcas] XP_012475378.1 PREDICTED: 60S ribosomal protein L37a [Gossypium raimondii] XP_012475789.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Gossypium raimondii] XP_012486779.1 PREDICTED: 60S ribosomal protein L37a [Gossypium raimondii] XP_012439403.1 PREDICTED: 60S ribosomal protein L37a [Gossypium raimondii] XP_012439404.1 PREDICTED: 60S ribosomal protein L37a [Gossypium raimondii] XP_015083230.1 PREDICTED: 60S ribosomal protein L37a [Solanum pennellii] XP_015085596.1 PREDICTED: 60S ribosomal protein L37a [Solanum pennellii] XP_015085598.1 PREDICTED: 60S ribosomal protein L37a [Solanum pennellii] XP_006354681.2 PREDICTED: 60S ribosomal protein L37a [Solanum tuberosum] XP_015169494.1 PREDICTED: 60S ribosomal protein L37a [Solanum tuberosum] XP_016443665.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016447895.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016459874.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016464635.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016482299.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016486270.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016495148.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016435128.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016440705.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana tabacum] XP_016570820.1 PREDICTED: 60S ribosomal protein L37a [Capsicum annuum] XP_016544343.1 PREDICTED: 60S ribosomal protein L37a [Capsicum annuum] XP_016716653.1 PREDICTED: 60S ribosomal protein L37a [Gossypium hirsutum] XP_016665842.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Gossypium hirsutum] XP_016677215.1 PREDICTED: 60S ribosomal protein L37a [Gossypium hirsutum] XP_016681999.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Gossypium hirsutum] XP_016736628.1 PREDICTED: 60S ribosomal protein L37a [Gossypium hirsutum] XP_016736629.1 PREDICTED: 60S ribosomal protein L37a [Gossypium hirsutum] XP_017611253.1 PREDICTED: 60S ribosomal protein L37a [Gossypium arboreum] XP_017626460.1 PREDICTED: 60S ribosomal protein L37a [Gossypium arboreum] XP_017634972.1 PREDICTED: 60S ribosomal protein L37a [Gossypium arboreum] XP_019188287.1 PREDICTED: 60S ribosomal protein L37a [Ipomoea nil] XP_019190693.1 PREDICTED: 60S ribosomal protein L37a [Ipomoea nil] XP_019159486.1 PREDICTED: 60S ribosomal protein L37a isoform X1 [Ipomoea nil] XP_019168278.1 PREDICTED: 60S ribosomal protein L37a [Ipomoea nil] XP_019259287.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana attenuata] XP_019264119.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana attenuata] XP_019236663.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana attenuata] XP_019239719.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana attenuata] XP_019244840.1 PREDICTED: 60S ribosomal protein L37a [Nicotiana attenuata] EOX96554.1 Zinc-binding ribosomal protein family protein [Theobroma cacao] EOY24139.1 Zinc-binding ribosomal protein family protein [Theobroma cacao] ESR53383.1 hypothetical protein CICLE_v10023068mg [Citrus clementina] ESR58706.1 hypothetical protein CICLE_v10022898mg [Citrus clementina] KDP28892.1 hypothetical protein JCGZ_14663 [Jatropha curcas] KGN56697.1 hypothetical protein Csa_3G129540 [Cucumis sativus] KGN60452.1 hypothetical protein Csa_3G912355 [Cucumis sativus] KGN61424.1 hypothetical protein Csa_2G120410 [Cucumis sativus] KHG10633.1 60S ribosomal L37a [Gossypium arboreum] KJB24910.1 hypothetical protein B456_004G167500 [Gossypium raimondii] KJB25407.1 hypothetical protein B456_004G190800 [Gossypium raimondii] KJB37666.1 hypothetical protein B456_006G214900 [Gossypium raimondii] KJB51745.1 hypothetical protein B456_008G230300 [Gossypium raimondii] KJB51746.1 hypothetical protein B456_008G230300 [Gossypium raimondii] KVH89752.1 Ribosomal protein L37ae [Cynara cardunculus var. scolymus] KVH95262.1 Ribosomal protein L37ae [Cynara cardunculus var. scolymus] OIT07838.1 60s ribosomal protein l37a [Nicotiana attenuata] OIT22964.1 60s ribosomal protein l37a [Nicotiana attenuata] OIT39944.1 60s ribosomal protein l37a [Nicotiana attenuata] OMO69695.1 Ribosomal protein L37ae [Corchorus capsularis] OMO70107.1 Ribosomal protein L37ae [Corchorus capsularis] OMP00783.1 Ribosomal protein L37ae [Corchorus olitorius] ONI06315.1 hypothetical protein PRUPE_5G052800 [Prunus persica] ONI22289.1 hypothetical protein PRUPE_2G119100 [Prunus persica] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >AFW90557.1 60S ribosomal protein L37a [Solanum tuberosum] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >XP_002526487.1 PREDICTED: 60S ribosomal protein L37a [Ricinus communis] XP_003521053.1 PREDICTED: 60S ribosomal protein L37a [Glycine max] XP_003524259.1 PREDICTED: 60S ribosomal protein L37a [Glycine max] XP_003529019.1 PREDICTED: 60S ribosomal protein L37a isoform X1 [Glycine max] XP_003549958.1 PREDICTED: 60S ribosomal protein L37a [Glycine max] XP_003608819.1 60S ribosomal protein L37a-2 [Medicago truncatula] XP_004508976.1 PREDICTED: 60S ribosomal protein L37a [Cicer arietinum] XP_004510797.1 PREDICTED: 60S ribosomal protein L37a [Cicer arietinum] XP_004511750.1 PREDICTED: 60S ribosomal protein L37a [Cicer arietinum] XP_006385384.1 60S ribosomal protein L37a [Populus trichocarpa] XP_006385584.1 hypothetical protein POPTR_0003s08320g [Populus trichocarpa] XP_006375190.1 hypothetical protein POPTR_0014s05130g [Populus trichocarpa] XP_007134392.1 hypothetical protein PHAVU_010G044100g [Phaseolus vulgaris] XP_007155727.1 hypothetical protein PHAVU_003G226400g [Phaseolus vulgaris] XP_011032654.1 PREDICTED: 60S ribosomal protein L37a [Populus euphratica] XP_011018671.1 PREDICTED: 60S ribosomal protein L37a [Populus euphratica] XP_013443911.1 60S ribosomal protein L37a-2 [Medicago truncatula] XP_013457563.1 60S ribosomal protein L37a-2 [Medicago truncatula] XP_014507735.1 PREDICTED: 60S ribosomal protein L37a [Vigna radiata var. radiata] XP_014515966.1 PREDICTED: 60S ribosomal protein L37a [Vigna radiata var. radiata] XP_015573670.1 PREDICTED: 60S ribosomal protein L37a isoform X2 [Ricinus communis] XP_015959819.1 PREDICTED: 60S ribosomal protein L37a [Arachis duranensis] XP_015963449.1 PREDICTED: 60S ribosomal protein L37a [Arachis duranensis] XP_015938933.1 PREDICTED: 60S ribosomal protein L37a [Arachis duranensis] XP_016187158.1 PREDICTED: 60S ribosomal protein L37a [Arachis ipaensis] XP_016200614.1 PREDICTED: 60S ribosomal protein L37a [Arachis ipaensis] XP_016176976.1 PREDICTED: 60S ribosomal protein L37a [Arachis ipaensis] XP_017428208.1 PREDICTED: 60S ribosomal protein L37a [Vigna angularis] XP_017441579.1 PREDICTED: 60S ribosomal protein L37a [Vigna angularis] ABK93424.1 unknown [Populus trichocarpa] ABK94356.1 unknown [Populus trichocarpa] ACJ83897.1 unknown [Medicago truncatula] EEF35878.1 60S ribosomal protein L37a, putative [Ricinus communis] AES91016.1 60S ribosomal protein L37a-2 [Medicago truncatula] AFK35087.1 unknown [Medicago truncatula] AFK45234.1 unknown [Medicago truncatula] AFK48455.1 unknown [Medicago truncatula] ERP52987.1 hypothetical protein POPTR_0014s05130g [Populus trichocarpa] ERP63181.1 60S ribosomal protein L37a [Populus trichocarpa] ERP63381.1 hypothetical protein POPTR_0003s08320g [Populus trichocarpa] ESW06386.1 hypothetical protein PHAVU_010G044100g [Phaseolus vulgaris] ESW27721.1 hypothetical protein PHAVU_003G226400g [Phaseolus vulgaris] KEH17936.1 60S ribosomal protein L37a-2 [Medicago truncatula] KEH31594.1 60S ribosomal protein L37a-2 [Medicago truncatula] KHN01605.1 60S ribosomal protein L37a [Glycine soja] KHN01644.1 60S ribosomal protein L37a [Glycine soja] KHN08408.1 60S ribosomal protein L37a [Glycine soja] KHN31100.1 60S ribosomal protein L37a [Glycine soja] KRH04256.1 hypothetical protein GLYMA_17G149600 [Glycine max] KRH48874.1 hypothetical protein GLYMA_07G118600 [Glycine max] KRH57541.1 hypothetical protein GLYMA_05G067400 [Glycine max] KRH66443.1 hypothetical protein GLYMA_03G107000 [Glycine max] BAT96866.1 hypothetical protein VIGAN_09017500 [Vigna angularis var. angularis] KYP40620.1 60S ribosomal protein L37a [Cajanus cajan] OAY24532.1 hypothetical protein MANES_17G022800 [Manihot esculenta] OAY29767.1 hypothetical protein MANES_15G170900 [Manihot esculenta] OAY49452.1 hypothetical protein MANES_05G057400 [Manihot esculenta] GAU38221.1 hypothetical protein TSUD_226420 [Trifolium subterraneum] GAU28528.1 hypothetical protein TSUD_156850 [Trifolium subterraneum] GAU24795.1 hypothetical protein TSUD_157080 [Trifolium subterraneum] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >CAI48073.1 60S ribosomal protein L37a [Capsicum chinense] Length = 92 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 44 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >XP_015573669.1 PREDICTED: 60S ribosomal protein L37a isoform X1 [Ricinus communis] KYP67103.1 60S ribosomal protein L37a [Cajanus cajan] Length = 93 Score = 100 bits (248), Expect = 9e-25 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 362 QYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 216 +YAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 45 KYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 93