BLASTX nr result
ID: Glycyrrhiza28_contig00015924
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00015924 (229 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007270721.1 hypothetical protein FOMMEDRAFT_95236, partial [F... 53 2e-07 XP_018267523.1 hypothetical protein RHOBADRAFT_19397 [Rhodotorul... 48 9e-06 >XP_007270721.1 hypothetical protein FOMMEDRAFT_95236, partial [Fomitiporia mediterranea MF3/22] XP_007272416.1 hypothetical protein FOMMEDRAFT_100095, partial [Fomitiporia mediterranea MF3/22] EJC97320.1 hypothetical protein FOMMEDRAFT_100095, partial [Fomitiporia mediterranea MF3/22] EJC98830.1 hypothetical protein FOMMEDRAFT_95236, partial [Fomitiporia mediterranea MF3/22] Length = 103 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 139 MVHKPKLYLNTTNMCGTNIIVSGTDSDLEA 228 +VH+PKLY NTT+MC TNIIVSGTDS LEA Sbjct: 3 VVHEPKLYFNTTHMCRTNIIVSGTDSGLEA 32 >XP_018267523.1 hypothetical protein RHOBADRAFT_19397 [Rhodotorula graminis WP1] XP_018267529.1 hypothetical protein RHOBADRAFT_19401 [Rhodotorula graminis WP1] XP_018267542.1 hypothetical protein RHOBADRAFT_19413 [Rhodotorula graminis WP1] XP_018267504.1 hypothetical protein RHOBADRAFT_19437 [Rhodotorula graminis WP1] XP_018267535.1 hypothetical protein RHOBADRAFT_19445 [Rhodotorula graminis WP1] XP_018267499.1 hypothetical protein RHOBADRAFT_19446 [Rhodotorula graminis WP1] XP_018267511.1 hypothetical protein RHOBADRAFT_19473 [Rhodotorula graminis WP1] XP_018267517.1 hypothetical protein RHOBADRAFT_19482 [Rhodotorula graminis WP1] KPV71450.1 hypothetical protein RHOBADRAFT_19446 [Rhodotorula graminis WP1] KPV71455.1 hypothetical protein RHOBADRAFT_19437 [Rhodotorula graminis WP1] KPV71462.1 hypothetical protein RHOBADRAFT_19473 [Rhodotorula graminis WP1] KPV71468.1 hypothetical protein RHOBADRAFT_19482 [Rhodotorula graminis WP1] KPV71474.1 hypothetical protein RHOBADRAFT_19397 [Rhodotorula graminis WP1] KPV71480.1 hypothetical protein RHOBADRAFT_19401 [Rhodotorula graminis WP1] KPV71486.1 hypothetical protein RHOBADRAFT_19445 [Rhodotorula graminis WP1] KPV71493.1 hypothetical protein RHOBADRAFT_19413 [Rhodotorula graminis WP1] Length = 61 Score = 48.1 bits (113), Expect = 9e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 139 MVHKPKLYLNTTNMCGTNIIVSGTDSDLEA 228 MV++PKLYL +T +CGTNIIVS TDS LEA Sbjct: 1 MVYEPKLYLYSTKICGTNIIVSSTDSGLEA 30