BLASTX nr result
ID: Glycyrrhiza28_contig00015653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00015653 (229 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007213618.1 hypothetical protein PRUPE_ppa002169mg [Prunus pe... 129 4e-33 XP_009379098.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 6e-33 XP_008370969.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 6e-33 XP_008224621.1 PREDICTED: pentatricopeptide repeat-containing pr... 127 2e-32 XP_015879093.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 2e-31 XP_004507605.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 2e-31 XP_008464281.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 9e-31 XP_004139516.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 9e-31 XP_009374903.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 122 1e-30 EOY28969.1 Pentatricopeptide (PPR) repeat-containing protein [Th... 121 2e-30 XP_002308816.1 hypothetical protein POPTR_0006s01990g [Populus t... 120 3e-30 XP_016195774.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 3e-30 XP_015940563.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 3e-30 CDO45567.1 Pentatricopeptide repeat-containing protein, partial ... 114 4e-30 XP_010057810.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 4e-30 XP_010252754.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 4e-30 CDG58491.1 pentatricopeptide repeat-containing protein, partial ... 114 4e-30 CDO45541.1 Pentatricopeptide repeat-containing protein, partial ... 114 6e-30 CDG58480.1 pentatricopeptide repeat-containing protein, partial ... 114 6e-30 XP_007026347.2 PREDICTED: pentatricopeptide repeat-containing pr... 119 8e-30 >XP_007213618.1 hypothetical protein PRUPE_ppa002169mg [Prunus persica] ONI09720.1 hypothetical protein PRUPE_4G005200 [Prunus persica] Length = 706 Score = 129 bits (323), Expect = 4e-33 Identities = 60/69 (86%), Positives = 65/69 (94%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLASVF+S+LKELNAPFHEAPDKAGWFLTT+VAVKSWLES Sbjct: 638 ELPPLLGINTGHGKHKYSDKGLASVFESHLKELNAPFHEAPDKAGWFLTTKVAVKSWLES 697 Query: 44 SGSSELAPA 18 SSEL A Sbjct: 698 RSSSELVAA 706 >XP_009379098.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Pyrus x bretschneideri] Length = 709 Score = 128 bits (322), Expect = 6e-33 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLASVF+S+LKELNAPFHEAPDKAGWFLTT+VA+KSWLES Sbjct: 641 ELPPLLGINTGHGKHKYSDKGLASVFESHLKELNAPFHEAPDKAGWFLTTKVAIKSWLES 700 Query: 44 SGSSELAPA 18 SSEL A Sbjct: 701 RSSSELVTA 709 >XP_008370969.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Malus domestica] XP_017187984.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Malus domestica] XP_017187985.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Malus domestica] XP_017187986.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Malus domestica] Length = 709 Score = 128 bits (322), Expect = 6e-33 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLASVF+S+LKELNAPFHEAPDKAGWFLTT+VA+KSWLES Sbjct: 641 ELPPLLGINTGHGKHKYSDKGLASVFESHLKELNAPFHEAPDKAGWFLTTKVAIKSWLES 700 Query: 44 SGSSELAPA 18 SSEL A Sbjct: 701 RSSSELVTA 709 >XP_008224621.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Prunus mume] Length = 706 Score = 127 bits (319), Expect = 2e-32 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLASVF+S+LKELNAPFHEAPDKAGWFLTT+VAVKSWLES Sbjct: 638 ELPPLLGINTGHGKHKYSDKGLASVFESHLKELNAPFHEAPDKAGWFLTTKVAVKSWLES 697 Query: 44 SGSSELAPA 18 SSE A Sbjct: 698 RSSSEFVAA 706 >XP_015879093.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Ziziphus jujuba] Length = 703 Score = 124 bits (311), Expect = 2e-31 Identities = 57/69 (82%), Positives = 63/69 (91%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLASVF+S+LKELNAPFHEAPDK GWFLTT+VA KSWL+S Sbjct: 635 ELPPLLGINTGHGKHKYSDKGLASVFESHLKELNAPFHEAPDKVGWFLTTKVAAKSWLDS 694 Query: 44 SGSSELAPA 18 SSEL A Sbjct: 695 RNSSELIAA 703 >XP_004507605.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Cicer arietinum] Length = 688 Score = 124 bits (310), Expect = 2e-31 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 DLPPLLG+NTGHGKH+YSE+GLA F+S+LKELNAPFHEAPDKAGWFLTTQVAVKSW+E Sbjct: 620 DLPPLLGVNTGHGKHRYSERGLAGAFESHLKELNAPFHEAPDKAGWFLTTQVAVKSWMEP 679 Query: 44 SGSSELAPA 18 SSEL A Sbjct: 680 RRSSELVAA 688 >XP_008464281.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Cucumis melo] Length = 704 Score = 122 bits (306), Expect = 9e-31 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLASVF+S+LKELNAPFHEAP+K GWFLTT+VA KSWLES Sbjct: 636 ELPPLLGINTGHGKHKYSDKGLASVFESHLKELNAPFHEAPEKVGWFLTTKVAAKSWLES 695 Query: 44 SGSSELAPA 18 S EL A Sbjct: 696 RSSPELVAA 704 >XP_004139516.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Cucumis sativus] KGN64994.1 hypothetical protein Csa_1G173140 [Cucumis sativus] Length = 704 Score = 122 bits (306), Expect = 9e-31 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLASVF+S+LKELNAPFHEAP+K GWFLTT+VA KSWLES Sbjct: 636 ELPPLLGINTGHGKHKYSDKGLASVFESHLKELNAPFHEAPEKVGWFLTTKVAAKSWLES 695 Query: 44 SGSSELAPA 18 S EL A Sbjct: 696 RSSPELVAA 704 >XP_009374903.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Pyrus x bretschneideri] Length = 603 Score = 122 bits (305), Expect = 1e-30 Identities = 58/69 (84%), Positives = 63/69 (91%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +L PLLGINTGHGKHKYSEKGLASVF+S++KELNAPFHEA DKAGWFLTT+VAVKSWLES Sbjct: 535 ELLPLLGINTGHGKHKYSEKGLASVFESHVKELNAPFHEASDKAGWFLTTKVAVKSWLES 594 Query: 44 SGSSELAPA 18 SSEL A Sbjct: 595 RSSSELVTA 603 >EOY28969.1 Pentatricopeptide (PPR) repeat-containing protein [Theobroma cacao] Length = 700 Score = 121 bits (303), Expect = 2e-30 Identities = 55/69 (79%), Positives = 62/69 (89%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLA+VF+S+LKEL+APFHEAPDK GWFLTTQVA KSWLES Sbjct: 632 ELPPLLGINTGHGKHKYSDKGLATVFESHLKELDAPFHEAPDKVGWFLTTQVAAKSWLES 691 Query: 44 SGSSELAPA 18 S +L A Sbjct: 692 RSSPDLVAA 700 >XP_002308816.1 hypothetical protein POPTR_0006s01990g [Populus trichocarpa] EEE92339.1 hypothetical protein POPTR_0006s01990g [Populus trichocarpa] Length = 700 Score = 120 bits (302), Expect = 3e-30 Identities = 55/68 (80%), Positives = 62/68 (91%) Frame = -3 Query: 221 LPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLESS 42 LPPLLGINTGHGKHKYSEKGLA+VF+SYLKELN+PFHEAPDK GWFLTT+VA +SWLES Sbjct: 633 LPPLLGINTGHGKHKYSEKGLANVFESYLKELNSPFHEAPDKVGWFLTTKVAAESWLESR 692 Query: 41 GSSELAPA 18 S++ A A Sbjct: 693 KSTDAAAA 700 >XP_016195774.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Arachis ipaensis] Length = 705 Score = 120 bits (302), Expect = 3e-30 Identities = 55/66 (83%), Positives = 61/66 (92%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLA+VF+S+LKELNAPFHEAPDKAGWFLTT A KSWL+S Sbjct: 637 ELPPLLGINTGHGKHKYSDKGLANVFESHLKELNAPFHEAPDKAGWFLTTLEAAKSWLKS 696 Query: 44 SGSSEL 27 GS EL Sbjct: 697 KGSPEL 702 >XP_015940563.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Arachis duranensis] Length = 705 Score = 120 bits (302), Expect = 3e-30 Identities = 55/66 (83%), Positives = 61/66 (92%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLA+VF+S+LKELNAPFHEAPDKAGWFLTT A KSWL+S Sbjct: 637 ELPPLLGINTGHGKHKYSDKGLANVFESHLKELNAPFHEAPDKAGWFLTTLEAAKSWLKS 696 Query: 44 SGSSEL 27 GS EL Sbjct: 697 KGSPEL 702 >CDO45567.1 Pentatricopeptide repeat-containing protein, partial [Leucadendron sorocephalodes] Length = 216 Score = 114 bits (285), Expect = 4e-30 Identities = 51/69 (73%), Positives = 61/69 (88%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LP +LGINTGHGKHKYS+KGLASV +S+LK+L+APFHEAPDKAGWFLTT +A KSWL+S Sbjct: 148 ELPSVLGINTGHGKHKYSDKGLASVLESHLKDLSAPFHEAPDKAGWFLTTDIAAKSWLKS 207 Query: 44 SGSSELAPA 18 S+EL A Sbjct: 208 RSSAELVTA 216 >XP_010057810.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Eucalyptus grandis] XP_010057811.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Eucalyptus grandis] XP_018730473.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Eucalyptus grandis] KCW75129.1 hypothetical protein EUGRSUZ_E03880 [Eucalyptus grandis] Length = 706 Score = 120 bits (301), Expect = 4e-30 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLASVF+S+LKELNAPFHEAPDK GWFLTT++A +SWLES Sbjct: 638 ELPPLLGINTGHGKHKYSDKGLASVFESHLKELNAPFHEAPDKVGWFLTTKIAAQSWLES 697 Query: 44 SGSSEL 27 S EL Sbjct: 698 RSSLEL 703 >XP_010252754.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Nelumbo nucifera] XP_010252755.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Nelumbo nucifera] Length = 715 Score = 120 bits (301), Expect = 4e-30 Identities = 55/69 (79%), Positives = 61/69 (88%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLA VF S+LKELNAPFHEAPDKAGWFLTT+VA KSWLES Sbjct: 647 ELPPLLGINTGHGKHKYSDKGLAGVFASHLKELNAPFHEAPDKAGWFLTTKVAAKSWLES 706 Query: 44 SGSSELAPA 18 S ++ A Sbjct: 707 RSSPDIVAA 715 >CDG58491.1 pentatricopeptide repeat-containing protein, partial [Leucadendron loeriense] Length = 206 Score = 114 bits (284), Expect = 4e-30 Identities = 51/69 (73%), Positives = 60/69 (86%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LP +LGINTGHGKHKYS+KGLASV +S+LKEL+APFHEAPDK GWFLTT +A KSWL+S Sbjct: 138 ELPSVLGINTGHGKHKYSDKGLASVLESHLKELSAPFHEAPDKVGWFLTTDIAAKSWLKS 197 Query: 44 SGSSELAPA 18 S+EL A Sbjct: 198 RSSAELVTA 206 >CDO45541.1 Pentatricopeptide repeat-containing protein, partial [Leucadendron olens] CDO45542.1 Pentatricopeptide repeat-containing protein, partial [Leucadendron olens] Length = 216 Score = 114 bits (284), Expect = 6e-30 Identities = 51/69 (73%), Positives = 60/69 (86%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LP +LGINTGHGKHKYS+KGLASV +S+LKEL+APFHEAPDK GWFLTT +A KSWL+S Sbjct: 148 ELPSVLGINTGHGKHKYSDKGLASVLESHLKELSAPFHEAPDKVGWFLTTDIAAKSWLKS 207 Query: 44 SGSSELAPA 18 S+EL A Sbjct: 208 RSSAELVTA 216 >CDG58480.1 pentatricopeptide repeat-containing protein, partial [Leucadendron conicum] CDO45553.1 Pentatricopeptide repeat-containing protein, partial [Leucadendron radiatum] CDO45554.1 Pentatricopeptide repeat-containing protein, partial [Leucadendron radiatum] Length = 216 Score = 114 bits (284), Expect = 6e-30 Identities = 51/69 (73%), Positives = 60/69 (86%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LP +LGINTGHGKHKYS+KGLASV +S+LKEL+APFHEAPDK GWFLTT +A KSWL+S Sbjct: 148 ELPSVLGINTGHGKHKYSDKGLASVLESHLKELSAPFHEAPDKVGWFLTTDIAAKSWLKS 207 Query: 44 SGSSELAPA 18 S+EL A Sbjct: 208 RSSAELVTA 216 >XP_007026347.2 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Theobroma cacao] Length = 700 Score = 119 bits (299), Expect = 8e-30 Identities = 54/69 (78%), Positives = 61/69 (88%) Frame = -3 Query: 224 DLPPLLGINTGHGKHKYSEKGLASVFDSYLKELNAPFHEAPDKAGWFLTTQVAVKSWLES 45 +LPPLLGINTGHGKHKYS+KGLA+VF+S+LKEL+ PFHEAPDK GWFLTTQVA KSWLES Sbjct: 632 ELPPLLGINTGHGKHKYSDKGLATVFESHLKELDTPFHEAPDKVGWFLTTQVAAKSWLES 691 Query: 44 SGSSELAPA 18 S +L A Sbjct: 692 RSSPDLVAA 700